Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | ykfI-yfjZ/CbtA-CbeA |
Location | 610765..611468 | Replicon | chromosome |
Accession | NZ_CP100511 | ||
Organism | Klebsiella pneumoniae strain LH50-a |
Toxin (Protein)
Gene name | ykfI | Uniprot ID | - |
Locus tag | NLZ12_RS02915 | Protein ID | WP_126800543.1 |
Coordinates | 611127..611468 (+) | Length | 114 a.a. |
Antitoxin (Protein)
Gene name | yfjZ | Uniprot ID | - |
Locus tag | NLZ12_RS02910 | Protein ID | WP_254541277.1 |
Coordinates | 610765..611106 (+) | Length | 114 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NLZ12_RS02875 (NLZ12_02875) | 605918..606793 | + | 876 | WP_254541274.1 | GTPase family protein | - |
NLZ12_RS02880 (NLZ12_02880) | 607036..607770 | + | 735 | WP_254541275.1 | WYL domain-containing protein | - |
NLZ12_RS02885 (NLZ12_02885) | 607787..608239 | + | 453 | WP_254541276.1 | hypothetical protein | - |
NLZ12_RS02890 (NLZ12_02890) | 608311..608784 | + | 474 | WP_060175535.1 | hypothetical protein | - |
NLZ12_RS02895 (NLZ12_02895) | 608904..609725 | + | 822 | WP_126800547.1 | DUF932 domain-containing protein | - |
NLZ12_RS02900 (NLZ12_02900) | 609756..610199 | + | 444 | WP_126800546.1 | antirestriction protein | - |
NLZ12_RS02905 (NLZ12_02905) | 610212..610754 | + | 543 | WP_126800545.1 | DNA repair protein RadC | - |
NLZ12_RS02910 (NLZ12_02910) | 610765..611106 | + | 342 | WP_254541277.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
NLZ12_RS02915 (NLZ12_02915) | 611127..611468 | + | 342 | WP_126800543.1 | TA system toxin CbtA family protein | Toxin |
NLZ12_RS02920 (NLZ12_02920) | 611592..612560 | + | 969 | WP_072202751.1 | IS5 family transposase | - |
NLZ12_RS02925 (NLZ12_02925) | 612726..614759 | - | 2034 | WP_126800542.1 | hypothetical protein | - |
NLZ12_RS02930 (NLZ12_02930) | 615354..616222 | - | 869 | Protein_577 | HNH endonuclease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 581277..615512 | 34235 | |
- | flank | IS/Tn | - | - | 611637..612560 | 923 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 13023.09 Da Isoelectric Point: 10.6066
>T250709 WP_126800543.1 NZ_CP100511:611127-611468 [Klebsiella pneumoniae]
MKTLPATTQRAAKLYLSPVAVWQMLLARLLEQHHGLILNDTPFSDEAVIQEHINAGINLADAVNFLMEKYELVRIDRRGF
NWQEQSPYLRAVDILRARQATGLLRRSRKNAVR
MKTLPATTQRAAKLYLSPVAVWQMLLARLLEQHHGLILNDTPFSDEAVIQEHINAGINLADAVNFLMEKYELVRIDRRGF
NWQEQSPYLRAVDILRARQATGLLRRSRKNAVR
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|