Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 520341..520857 | Replicon | chromosome |
| Accession | NZ_CP100511 | ||
| Organism | Klebsiella pneumoniae strain LH50-a | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | R4YAY3 |
| Locus tag | NLZ12_RS02540 | Protein ID | WP_004178374.1 |
| Coordinates | 520573..520857 (+) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | NLZ12_RS02535 | Protein ID | WP_254541262.1 |
| Coordinates | 520341..520583 (+) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NLZ12_RS02520 (NLZ12_02520) | 516369..517109 | + | 741 | WP_002886899.1 | KDGP aldolase family protein | - |
| NLZ12_RS02525 (NLZ12_02525) | 517176..518330 | + | 1155 | WP_032415878.1 | lactonase family protein | - |
| NLZ12_RS02530 (NLZ12_02530) | 518353..520263 | + | 1911 | WP_009486549.1 | PRD domain-containing protein | - |
| NLZ12_RS02535 (NLZ12_02535) | 520341..520583 | + | 243 | WP_254541262.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| NLZ12_RS02540 (NLZ12_02540) | 520573..520857 | + | 285 | WP_004178374.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NLZ12_RS02545 (NLZ12_02545) | 520861..521325 | - | 465 | WP_004178375.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
| NLZ12_RS02550 (NLZ12_02550) | 521654..523792 | - | 2139 | WP_032415880.1 | anaerobic ribonucleoside-triphosphate reductase | - |
| NLZ12_RS02555 (NLZ12_02555) | 524149..524892 | - | 744 | WP_159308131.1 | MurR/RpiR family transcriptional regulator | - |
| NLZ12_RS02560 (NLZ12_02560) | 524895..525068 | - | 174 | WP_004146781.1 | hypothetical protein | - |
| NLZ12_RS02565 (NLZ12_02565) | 525198..525461 | + | 264 | WP_014908078.1 | PTS sugar transporter subunit IIB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11155.97 Da Isoelectric Point: 10.3787
>T250708 WP_004178374.1 NZ_CP100511:520573-520857 [Klebsiella pneumoniae]
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|