Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | phd-doc/Doc-Phd |
| Location | 17768..18369 | Replicon | plasmid pLH50-c-C |
| Accession | NZ_CP100503 | ||
| Organism | Escherichia coli strain LH50-c | ||
Toxin (Protein)
| Gene name | doc | Uniprot ID | V0AJ64 |
| Locus tag | NLZ13_RS28525 | Protein ID | WP_001216034.1 |
| Coordinates | 17989..18369 (+) | Length | 127 a.a. |
Antitoxin (Protein)
| Gene name | phd | Uniprot ID | U9YQH9 |
| Locus tag | NLZ13_RS28520 | Protein ID | WP_001190712.1 |
| Coordinates | 17768..17989 (+) | Length | 74 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NLZ13_RS28510 (NLZ13_28515) | 14794..16032 | - | 1239 | WP_204154746.1 | restriction endonuclease subunit S | - |
| NLZ13_RS28515 (NLZ13_28520) | 16029..17585 | - | 1557 | WP_254539448.1 | type I restriction-modification system subunit M | - |
| NLZ13_RS28520 (NLZ13_28525) | 17768..17989 | + | 222 | WP_001190712.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| NLZ13_RS28525 (NLZ13_28530) | 17989..18369 | + | 381 | WP_001216034.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
| NLZ13_RS28530 (NLZ13_28535) | 18374..18553 | + | 180 | WP_001513661.1 | hypothetical protein | - |
| NLZ13_RS28535 (NLZ13_28540) | 18581..19624 | + | 1044 | WP_001561086.1 | DUF968 domain-containing protein | - |
| NLZ13_RS28540 (NLZ13_28545) | 19713..20165 | + | 453 | WP_032165150.1 | Late promoter-activating protein | - |
| NLZ13_RS28545 (NLZ13_28550) | 20251..21444 | + | 1194 | WP_000219616.1 | hypothetical protein | - |
| NLZ13_RS28550 (NLZ13_28555) | 21486..22928 | + | 1443 | WP_254539449.1 | terminase | - |
| NLZ13_RS28555 (NLZ13_28560) | 23140..23241 | + | 102 | Protein_25 | transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..64795 | 64795 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 127 a.a. Molecular weight: 13615.32 Da Isoelectric Point: 5.1514
>T250700 WP_001216034.1 NZ_CP100503:17989-18369 [Escherichia coli]
MRHISPEELIALHDANINRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE
MRHISPEELIALHDANINRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE
Download Length: 381 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | V0AJ64 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CJB6 |