Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vagCD/VapC-VagC |
Location | 49396..50039 | Replicon | plasmid pLH50-c-A |
Accession | NZ_CP100501 | ||
Organism | Escherichia coli strain LH50-c |
Toxin (Protein)
Gene name | vagD | Uniprot ID | B1LRW4 |
Locus tag | NLZ13_RS27275 | Protein ID | WP_001044768.1 |
Coordinates | 49396..49812 (-) | Length | 139 a.a. |
Antitoxin (Protein)
Gene name | vagC | Uniprot ID | D2WFK3 |
Locus tag | NLZ13_RS27280 | Protein ID | WP_001261287.1 |
Coordinates | 49809..50039 (-) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NLZ13_RS27250 (NLZ13_27255) | 44543..44827 | + | 285 | WP_012006537.1 | ribbon-helix-helix domain-containing protein | - |
NLZ13_RS27255 (NLZ13_27260) | 44827..45102 | + | 276 | WP_000421266.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
NLZ13_RS27260 (NLZ13_27265) | 45208..45447 | + | 240 | WP_001105068.1 | hypothetical protein | - |
NLZ13_RS27265 (NLZ13_27270) | 45610..46782 | - | 1173 | WP_062893848.1 | IS91 family transposase | - |
NLZ13_RS27270 (NLZ13_27275) | 47140..49234 | + | 2095 | Protein_49 | AAA family ATPase | - |
NLZ13_RS27275 (NLZ13_27280) | 49396..49812 | - | 417 | WP_001044768.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
NLZ13_RS27280 (NLZ13_27285) | 49809..50039 | - | 231 | WP_001261287.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
NLZ13_RS27285 (NLZ13_27290) | 50599..51012 | + | 414 | WP_062893835.1 | hypothetical protein | - |
NLZ13_RS27290 (NLZ13_27295) | 51014..51799 | + | 786 | WP_062893836.1 | site-specific integrase | - |
NLZ13_RS27295 (NLZ13_27300) | 52401..53033 | + | 633 | WP_000312331.1 | ParA family protein | - |
NLZ13_RS27300 (NLZ13_27305) | 53033..53407 | + | 375 | WP_000752652.1 | hypothetical protein | - |
NLZ13_RS27305 (NLZ13_27310) | 53646..54620 | + | 975 | WP_001217833.1 | plasmid segregation protein ParM | - |
NLZ13_RS27310 (NLZ13_27315) | 54624..55016 | + | 393 | WP_112038214.1 | plasmid partitioning/stability family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | - | - | 1..139970 | 139970 | |
- | inside | IScluster/Tn | - | - | 30364..46902 | 16538 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15197.66 Da Isoelectric Point: 7.7805
>T250694 WP_001044768.1 NZ_CP100501:c49812-49396 [Escherichia coli]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDEFCARLDAILPWDRA
AVDATTKIKVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPDLVLEDWVK
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDEFCARLDAILPWDRA
AVDATTKIKVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPDLVLEDWVK
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A606Q844 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QFC4 |