Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 5041931..5042800 | Replicon | chromosome |
| Accession | NZ_CP100500 | ||
| Organism | Escherichia coli strain LH50-c | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A1M1ISH3 |
| Locus tag | NLZ13_RS24635 | Protein ID | WP_039023580.1 |
| Coordinates | 5042390..5042800 (+) | Length | 137 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A0X5FMN2 |
| Locus tag | NLZ13_RS24630 | Protein ID | WP_039023579.1 |
| Coordinates | 5041931..5042299 (+) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NLZ13_RS24600 (5038005) | 5038005..5038889 | + | 885 | WP_000010380.1 | YfjP family GTPase | - |
| NLZ13_RS24605 (5039075) | 5039075..5039893 | + | 819 | WP_001234689.1 | DUF932 domain-containing protein | - |
| NLZ13_RS24610 (5039975) | 5039975..5040454 | + | 480 | WP_112037947.1 | antirestriction protein | - |
| NLZ13_RS24615 (5040470) | 5040470..5040946 | + | 477 | WP_001186726.1 | RadC family protein | - |
| NLZ13_RS24620 (5041009) | 5041009..5041230 | + | 222 | WP_000692298.1 | DUF987 domain-containing protein | - |
| NLZ13_RS24625 (5041249) | 5041249..5041881 | + | 633 | Protein_4834 | antitoxin of toxin-antitoxin stability system | - |
| NLZ13_RS24630 (5041931) | 5041931..5042299 | + | 369 | WP_039023579.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| NLZ13_RS24635 (5042390) | 5042390..5042800 | + | 411 | WP_039023580.1 | TA system toxin CbtA family protein | Toxin |
| NLZ13_RS24640 (5042763) | 5042763..5042912 | + | 150 | Protein_4837 | DUF5983 family protein | - |
| NLZ13_RS24645 (5042988) | 5042988..5043185 | + | 198 | WP_085975623.1 | DUF957 domain-containing protein | - |
| NLZ13_RS24650 (5043270) | 5043270..5043830 | + | 561 | Protein_4839 | DUF4942 domain-containing protein | - |
| NLZ13_RS24655 (5044667) | 5044667..5046205 | + | 1539 | WP_001187177.1 | lysine decarboxylation/transport transcriptional activator CadC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 5028216..5054018 | 25802 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 15253.38 Da Isoelectric Point: 7.2150
>T250689 WP_039023580.1 NZ_CP100500:5042390-5042800 [Escherichia coli]
MKLLPDTHVREASCCPSPVTIWQTLLIRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYRMVNNITLGSIRGRNDETFPDAGSRQR
MKLLPDTHVREASCCPSPVTIWQTLLIRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYRMVNNITLGSIRGRNDETFPDAGSRQR
Download Length: 411 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13672.49 Da Isoelectric Point: 6.7393
>AT250689 WP_039023579.1 NZ_CP100500:5041931-5042299 [Escherichia coli]
VSDTLSGITHPDDNHDRPWWGLPCTVRPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
VSDTLSGITHPDDNHDRPWWGLPCTVRPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1M1ISH3 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0X5FMN2 |