Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 4160899..4161517 | Replicon | chromosome |
Accession | NZ_CP100500 | ||
Organism | Escherichia coli strain LH50-c |
Toxin (Protein)
Gene name | Hha | Uniprot ID | H5UYE2 |
Locus tag | NLZ13_RS20580 | Protein ID | WP_001291435.1 |
Coordinates | 4161299..4161517 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | S1PTH5 |
Locus tag | NLZ13_RS20575 | Protein ID | WP_000344800.1 |
Coordinates | 4160899..4161273 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NLZ13_RS20565 (4155988) | 4155988..4157181 | + | 1194 | WP_001295324.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
NLZ13_RS20570 (4157204) | 4157204..4160353 | + | 3150 | WP_001132469.1 | efflux RND transporter permease AcrB | - |
NLZ13_RS20575 (4160899) | 4160899..4161273 | + | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
NLZ13_RS20580 (4161299) | 4161299..4161517 | + | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
NLZ13_RS20585 (4161689) | 4161689..4162240 | + | 552 | WP_000102564.1 | maltose O-acetyltransferase | - |
NLZ13_RS20590 (4162356) | 4162356..4162826 | + | 471 | WP_000136192.1 | YlaC family protein | - |
NLZ13_RS20595 (4162990) | 4162990..4164540 | + | 1551 | WP_001362407.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
NLZ13_RS20600 (4164582) | 4164582..4164935 | - | 354 | WP_112037988.1 | DUF1428 family protein | - |
NLZ13_RS20610 (4165314) | 4165314..4165625 | + | 312 | WP_000409914.1 | MGMT family protein | - |
NLZ13_RS20615 (4165656) | 4165656..4166228 | - | 573 | WP_000779831.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T250684 WP_001291435.1 NZ_CP100500:4161299-4161517 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT250684 WP_000344800.1 NZ_CP100500:4160899-4161273 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 2MW2 | |
PDB | 1JW2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QBQ5 |