Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
Location | 3527373..3528111 | Replicon | chromosome |
Accession | NZ_CP100500 | ||
Organism | Escherichia coli strain LH50-c |
Toxin (Protein)
Gene name | yeeV | Uniprot ID | D8EF64 |
Locus tag | NLZ13_RS17535 | Protein ID | WP_000847116.1 |
Coordinates | 3527373..3527750 (-) | Length | 126 a.a. |
Antitoxin (Protein)
Gene name | yeeU | Uniprot ID | - |
Locus tag | NLZ13_RS17540 | Protein ID | WP_143360777.1 |
Coordinates | 3527809..3528111 (-) | Length | 101 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NLZ13_RS17505 (3524032) | 3524032..3524736 | + | 705 | WP_001241678.1 | leucyl/phenylalanyl-tRNA--protein transferase | - |
NLZ13_RS17510 (3525021) | 3525021..3525239 | + | 219 | WP_001040187.1 | translation initiation factor IF-1 | - |
NLZ13_RS17520 (3525732) | 3525732..3526574 | - | 843 | WP_077473180.1 | DUF4942 domain-containing protein | - |
NLZ13_RS17525 (3526671) | 3526671..3526868 | - | 198 | WP_001349630.1 | DUF957 domain-containing protein | - |
NLZ13_RS17530 (3526888) | 3526888..3527376 | - | 489 | WP_000777671.1 | DUF5983 family protein | - |
NLZ13_RS17535 (3527373) | 3527373..3527750 | - | 378 | WP_000847116.1 | TA system toxin CbtA family protein | Toxin |
NLZ13_RS17540 (3527809) | 3527809..3528111 | - | 303 | WP_143360777.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
NLZ13_RS17545 (3528225) | 3528225..3528869 | - | 645 | WP_077473181.1 | antitoxin of toxin-antitoxin stability system | - |
NLZ13_RS17550 (3528886) | 3528886..3529107 | - | 222 | WP_000692361.1 | DUF987 domain-containing protein | - |
NLZ13_RS17555 (3529197) | 3529197..3529673 | - | 477 | WP_001186164.1 | RadC family protein | - |
NLZ13_RS17560 (3529685) | 3529685..3530158 | - | 474 | WP_000860015.1 | antirestriction protein | - |
NLZ13_RS17565 (3530263) | 3530263..3531081 | - | 819 | WP_072740735.1 | DUF932 domain-containing protein | - |
NLZ13_RS17570 (3531182) | 3531182..3531286 | - | 105 | WP_106421522.1 | DUF905 family protein | - |
NLZ13_RS17575 (3531486) | 3531486..3531851 | - | 366 | Protein_3455 | hypothetical protein | - |
NLZ13_RS17580 (3531848) | 3531848..3532039 | - | 192 | Protein_3456 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14053.10 Da Isoelectric Point: 7.8276
>T250683 WP_000847116.1 NZ_CP100500:c3527750-3527373 [Escherichia coli]
MKTFPDTHVRATSRCPSPVEIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGASSQLISSIDILRARRATGLMTRSHYRMVNNITLGKHCEVKP
MKTFPDTHVRATSRCPSPVEIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGASSQLISSIDILRARRATGLMTRSHYRMVNNITLGKHCEVKP
Download Length: 378 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|