Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 2709741..2710267 | Replicon | chromosome |
| Accession | NZ_CP100500 | ||
| Organism | Escherichia coli strain LH50-c | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | S1EXL1 |
| Locus tag | NLZ13_RS13340 | Protein ID | WP_000323025.1 |
| Coordinates | 2709741..2710028 (-) | Length | 96 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | S1F6D3 |
| Locus tag | NLZ13_RS13345 | Protein ID | WP_000534858.1 |
| Coordinates | 2710028..2710267 (-) | Length | 80 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NLZ13_RS13290 (2704765) | 2704765..2704980 | - | 216 | WP_000839590.1 | phage lysis protein EssD | - |
| NLZ13_RS13295 (2705200) | 2705200..2705370 | + | 171 | WP_001405948.1 | putative zinc-binding protein YnfU | - |
| NLZ13_RS13300 (2705734) | 2705734..2705949 | - | 216 | WP_000066484.1 | cold shock-like protein CspB | - |
| NLZ13_RS13305 (2706250) | 2706250..2706462 | + | 213 | WP_000087757.1 | cold shock-like protein CspF | - |
| NLZ13_RS13310 (2706517) | 2706517..2706606 | + | 90 | WP_120795389.1 | hypothetical protein | - |
| NLZ13_RS13315 (2706884) | 2706884..2707636 | - | 753 | WP_001047135.1 | antitermination protein | - |
| NLZ13_RS13320 (2707650) | 2707650..2708699 | - | 1050 | WP_254539427.1 | DUF968 domain-containing protein | - |
| NLZ13_RS13325 (2708701) | 2708701..2708979 | - | 279 | WP_032140164.1 | hypothetical protein | - |
| NLZ13_RS13330 (2709046) | 2709046..2709297 | - | 252 | WP_000981000.1 | protein Rem | - |
| NLZ13_RS13335 (2709514) | 2709514..2709669 | - | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | - |
| NLZ13_RS13340 (2709741) | 2709741..2710028 | - | 288 | WP_000323025.1 | type II toxin-antitoxin system mRNA interferase RelE | Toxin |
| NLZ13_RS13345 (2710028) | 2710028..2710267 | - | 240 | WP_000534858.1 | type II toxin-antitoxin system antitoxin RelB | Antitoxin |
| NLZ13_RS13350 (2710292) | 2710292..2710597 | + | 306 | WP_001326990.1 | protein YdfV | - |
| NLZ13_RS13355 (2710800) | 2710800..2711132 | + | 333 | WP_001301033.1 | FlxA-like family protein | - |
| NLZ13_RS13360 (2711569) | 2711569..2711718 | - | 150 | WP_180302674.1 | protein YdfW | - |
| NLZ13_RS13365 (2711839) | 2711839..2712888 | - | 1050 | Protein_2623 | ISNCY family transposase | - |
| NLZ13_RS13370 (2712942) | 2712942..2713361 | - | 420 | WP_001151195.1 | DUF977 family protein | - |
| NLZ13_RS13375 (2713402) | 2713402..2714367 | - | 966 | WP_000054506.1 | hypothetical protein | - |
| NLZ13_RS13380 (2714348) | 2714348..2714869 | - | 522 | WP_000705349.1 | toxin YdaT family protein | - |
| NLZ13_RS13385 (2714853) | 2714853..2715080 | - | 228 | WP_000476993.1 | Cro/CI family transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | - | vgrG/tssI / rhs/PAAR / espR1 / espR1 / fimA / sodB | 2479620..2805307 | 325687 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11225.22 Da Isoelectric Point: 10.1967
>T250678 WP_000323025.1 NZ_CP100500:c2710028-2709741 [Escherichia coli]
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|