Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
| Location | 2545320..2545958 | Replicon | chromosome |
| Accession | NZ_CP100500 | ||
| Organism | Escherichia coli strain LH50-c | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | A0A080J2T0 |
| Locus tag | NLZ13_RS12555 | Protein ID | WP_000813793.1 |
| Coordinates | 2545320..2545496 (+) | Length | 59 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | NLZ13_RS12560 | Protein ID | WP_001270286.1 |
| Coordinates | 2545542..2545958 (+) | Length | 139 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NLZ13_RS12535 (2540942) | 2540942..2542114 | - | 1173 | WP_001236210.1 | BenE family transporter YdcO | - |
| NLZ13_RS12540 (2542206) | 2542206..2542742 | + | 537 | WP_000429150.1 | DNA-binding transcriptional regulator SutR | - |
| NLZ13_RS12545 (2542815) | 2542815..2544776 | + | 1962 | WP_024257894.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
| NLZ13_RS12550 (2544868) | 2544868..2545098 | - | 231 | WP_000494244.1 | YncJ family protein | - |
| NLZ13_RS12555 (2545320) | 2545320..2545496 | + | 177 | WP_000813793.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
| NLZ13_RS12560 (2545542) | 2545542..2545958 | + | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
| NLZ13_RS12565 (2546037) | 2546037..2547443 | + | 1407 | WP_000760655.1 | PLP-dependent aminotransferase family protein | - |
| NLZ13_RS12570 (2547688) | 2547688..2548833 | + | 1146 | WP_000047419.1 | ABC transporter substrate-binding protein | - |
| NLZ13_RS12575 (2548851) | 2548851..2549864 | + | 1014 | WP_000220411.1 | ABC transporter ATP-binding protein | - |
| NLZ13_RS12580 (2549865) | 2549865..2550806 | + | 942 | WP_001251315.1 | ABC transporter permease | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | - | vgrG/tssI / rhs/PAAR / espR1 / espR1 / fimA / sodB | 2479620..2805307 | 325687 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6724.83 Da Isoelectric Point: 10.9223
>T250676 WP_000813793.1 NZ_CP100500:2545320-2545496 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGMRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGMRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT250676 WP_001270286.1 NZ_CP100500:2545542-2545958 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|