Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 1625627..1626252 | Replicon | chromosome |
Accession | NZ_CP100500 | ||
Organism | Escherichia coli strain LH50-c |
Toxin (Protein)
Gene name | vapC | Uniprot ID | U9YZ02 |
Locus tag | NLZ13_RS07980 | Protein ID | WP_000911329.1 |
Coordinates | 1625854..1626252 (+) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | U9XQV3 |
Locus tag | NLZ13_RS07975 | Protein ID | WP_000450524.1 |
Coordinates | 1625627..1625854 (+) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NLZ13_RS07950 (1621429) | 1621429..1621899 | - | 471 | WP_001068690.1 | thioredoxin-dependent thiol peroxidase | - |
NLZ13_RS07955 (1621899) | 1621899..1622471 | - | 573 | WP_000176187.1 | glycine cleavage system transcriptional repressor | - |
NLZ13_RS07960 (1622617) | 1622617..1623495 | + | 879 | WP_001295469.1 | 4-hydroxy-tetrahydrodipicolinate synthase | - |
NLZ13_RS07965 (1623512) | 1623512..1624546 | + | 1035 | WP_001297320.1 | outer membrane protein assembly factor BamC | - |
NLZ13_RS07970 (1624759) | 1624759..1625472 | + | 714 | WP_001295467.1 | phosphoribosylaminoimidazolesuccinocarboxamide synthase | - |
NLZ13_RS07975 (1625627) | 1625627..1625854 | + | 228 | WP_000450524.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
NLZ13_RS07980 (1625854) | 1625854..1626252 | + | 399 | WP_000911329.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
NLZ13_RS07985 (1626399) | 1626399..1627262 | + | 864 | WP_001267498.1 | neutral zinc metallopeptidase | - |
NLZ13_RS07990 (1627277) | 1627277..1629292 | + | 2016 | WP_089625697.1 | tRNA cytosine(34) acetyltransferase TmcA | - |
NLZ13_RS07995 (1629366) | 1629366..1630064 | + | 699 | WP_000679812.1 | esterase | - |
NLZ13_RS08000 (1630145) | 1630145..1630345 | - | 201 | WP_254539397.1 | YpfN family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integrative and Conjugative Element | - | algU | 1442080..1654414 | 212334 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14924.23 Da Isoelectric Point: 8.5325
>T250674 WP_000911329.1 NZ_CP100500:1625854-1626252 [Escherichia coli]
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLEVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLEVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0XW84 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CM33 |