Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
| Location | 1276538..1277121 | Replicon | chromosome |
| Accession | NZ_CP100500 | ||
| Organism | Escherichia coli strain LH50-c | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | U9Y5H3 |
| Locus tag | NLZ13_RS06245 | Protein ID | WP_000254735.1 |
| Coordinates | 1276786..1277121 (+) | Length | 112 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | U9Y5F1 |
| Locus tag | NLZ13_RS06240 | Protein ID | WP_000581936.1 |
| Coordinates | 1276538..1276786 (+) | Length | 83 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NLZ13_RS06230 (1272877) | 1272877..1274178 | + | 1302 | WP_000046797.1 | 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD | - |
| NLZ13_RS06235 (1274226) | 1274226..1276460 | + | 2235 | WP_000226815.1 | GTP pyrophosphokinase | - |
| NLZ13_RS06240 (1276538) | 1276538..1276786 | + | 249 | WP_000581936.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
| NLZ13_RS06245 (1276786) | 1276786..1277121 | + | 336 | WP_000254735.1 | endoribonuclease MazF | Toxin |
| NLZ13_RS06250 (1277193) | 1277193..1277984 | + | 792 | WP_001071673.1 | nucleoside triphosphate pyrophosphohydrolase | - |
| NLZ13_RS06255 (1278212) | 1278212..1279849 | + | 1638 | WP_000210878.1 | CTP synthase (glutamine hydrolyzing) | - |
| NLZ13_RS06260 (1279937) | 1279937..1281235 | + | 1299 | WP_000036723.1 | phosphopyruvate hydratase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 12070.03 Da Isoelectric Point: 8.2605
>T250673 WP_000254735.1 NZ_CP100500:1276786-1277121 [Escherichia coli]
MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRAKGATKKGTVAPEELQLIKAKINVLIG
MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRAKGATKKGTVAPEELQLIKAKINVLIG
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|