Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 1131098..1131752 | Replicon | chromosome |
| Accession | NZ_CP100500 | ||
| Organism | Escherichia coli strain LH50-c | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | S1EEB2 |
| Locus tag | NLZ13_RS05600 | Protein ID | WP_000244777.1 |
| Coordinates | 1131345..1131752 (+) | Length | 136 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | S1PPB1 |
| Locus tag | NLZ13_RS05595 | Protein ID | WP_000354046.1 |
| Coordinates | 1131098..1131364 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NLZ13_RS05575 (1127228) | 1127228..1127539 | + | 312 | WP_001182957.1 | N(4)-acetylcytidine aminohydrolase | - |
| NLZ13_RS05580 (1127703) | 1127703..1128362 | + | 660 | WP_000250270.1 | hemolysin III family protein | - |
| NLZ13_RS05585 (1128449) | 1128449..1129797 | + | 1349 | WP_100245061.1 | IS3-like element IS1397 family transposase | - |
| NLZ13_RS05590 (1129875) | 1129875..1130855 | - | 981 | WP_000886100.1 | tRNA-modifying protein YgfZ | - |
| NLZ13_RS05595 (1131098) | 1131098..1131364 | + | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
| NLZ13_RS05600 (1131345) | 1131345..1131752 | + | 408 | WP_000244777.1 | protein YgfX | Toxin |
| NLZ13_RS05605 (1131792) | 1131792..1132313 | - | 522 | WP_001055874.1 | flavodoxin FldB | - |
| NLZ13_RS05610 (1132425) | 1132425..1133321 | + | 897 | WP_000806630.1 | site-specific tyrosine recombinase XerD | - |
| NLZ13_RS05615 (1133346) | 1133346..1134056 | + | 711 | WP_000715218.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| NLZ13_RS05620 (1134062) | 1134062..1135795 | + | 1734 | WP_000813236.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16031.96 Da Isoelectric Point: 11.5202
>T250672 WP_000244777.1 NZ_CP100500:1131345-1131752 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9LFV7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 6B58 | |
| PDB | 1X6I | |
| PDB | 1X6J | |
| PDB | 6C12 | |
| AlphaFold DB | A0A7U9QD57 |