Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 955728..956529 | Replicon | chromosome |
| Accession | NZ_CP100500 | ||
| Organism | Escherichia coli strain LH50-c | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | - |
| Locus tag | NLZ13_RS04640 | Protein ID | WP_096986228.1 |
| Coordinates | 955728..956105 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | - |
| Locus tag | NLZ13_RS04645 | Protein ID | WP_099441937.1 |
| Coordinates | 956152..956529 (-) | Length | 126 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NLZ13_RS04610 (951698) | 951698..952963 | - | 1266 | WP_112038221.1 | integrase arm-type DNA-binding domain-containing protein | - |
| NLZ13_RS04615 (953422) | 953422..953739 | - | 318 | WP_099441941.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| NLZ13_RS04620 (953736) | 953736..953999 | - | 264 | WP_099441940.1 | type II toxin-antitoxin system ParD family antitoxin | - |
| NLZ13_RS04625 (954068) | 954068..954934 | - | 867 | WP_099441939.1 | DUF4942 domain-containing protein | - |
| NLZ13_RS04630 (955031) | 955031..955234 | - | 204 | WP_099441938.1 | DUF957 domain-containing protein | - |
| NLZ13_RS04635 (955243) | 955243..955731 | - | 489 | WP_096986227.1 | DUF5983 family protein | - |
| NLZ13_RS04640 (955728) | 955728..956105 | - | 378 | WP_096986228.1 | TA system toxin CbtA family protein | Toxin |
| NLZ13_RS04645 (956152) | 956152..956529 | - | 378 | WP_099441937.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| NLZ13_RS04650 (956567) | 956567..957209 | - | 643 | Protein_916 | antitoxin of toxin-antitoxin stability system | - |
| NLZ13_RS04655 (957226) | 957226..957420 | - | 195 | WP_238974235.1 | DUF987 family protein | - |
| NLZ13_RS04660 (957532) | 957532..958008 | - | 477 | WP_001186164.1 | RadC family protein | - |
| NLZ13_RS04665 (958020) | 958020..958493 | - | 474 | WP_112038220.1 | antirestriction protein | - |
| NLZ13_RS04670 (958595) | 958595..959413 | - | 819 | WP_099441935.1 | DUF932 domain-containing protein | - |
| NLZ13_RS04675 (959598) | 959598..960482 | - | 885 | WP_112038219.1 | YfjP family GTPase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 951698..984209 | 32511 | |
| - | inside | Genomic island | - | - | 950399..984209 | 33810 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14152.24 Da Isoelectric Point: 8.2976
>T250671 WP_096986228.1 NZ_CP100500:c956105-955728 [Escherichia coli]
MKTFPDTHVRAASRCPSPVEIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SASTRSQLISSIDILRARRATGLMTRSHYRMVNNITLGKHCEVKP
MKTFPDTHVRAASRCPSPVEIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SASTRSQLISSIDILRARRATGLMTRSHYRMVNNITLGKHCEVKP
Download Length: 378 bp
Antitoxin
Download Length: 126 a.a. Molecular weight: 13714.49 Da Isoelectric Point: 5.9467
>AT250671 WP_099441937.1 NZ_CP100500:c956529-956152 [Escherichia coli]
MSDTLTGTTHPDDNNNLPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRSRFSDADAYHLDQAFPLLMKQLELMLTSG
ELSPRHQHTVTLYAKGLTCEADTLGSCGYVYIAIYPTPATPGTTA
MSDTLTGTTHPDDNNNLPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRSRFSDADAYHLDQAFPLLMKQLELMLTSG
ELSPRHQHTVTLYAKGLTCEADTLGSCGYVYIAIYPTPATPGTTA
Download Length: 378 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|