Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
Location | 865035..865817 | Replicon | chromosome |
Accession | NZ_CP100500 | ||
Organism | Escherichia coli strain LH50-c |
Toxin (Protein)
Gene name | yeeV | Uniprot ID | A0A1M2EZB2 |
Locus tag | NLZ13_RS04165 | Protein ID | WP_000854831.1 |
Coordinates | 865035..865409 (-) | Length | 125 a.a. |
Antitoxin (Protein)
Gene name | yeeU | Uniprot ID | - |
Locus tag | NLZ13_RS04170 | Protein ID | WP_167823877.1 |
Coordinates | 865455..865817 (-) | Length | 121 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NLZ13_RS04140 (861133) | 861133..862014 | + | 882 | WP_000525605.1 | integrase domain-containing protein | - |
NLZ13_RS04145 (862196) | 862196..863463 | - | 1268 | Protein_815 | integrase arm-type DNA-binding domain-containing protein | - |
NLZ13_RS04150 (863758) | 863758..864600 | - | 843 | WP_112037804.1 | DUF4942 domain-containing protein | - |
NLZ13_RS04155 (864685) | 864685..864868 | - | 184 | Protein_817 | hypothetical protein | - |
NLZ13_RS04160 (864841) | 864841..865035 | - | 195 | Protein_818 | DUF5983 family protein | - |
NLZ13_RS04165 (865035) | 865035..865409 | - | 375 | WP_000854831.1 | type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA | Toxin |
NLZ13_RS04170 (865455) | 865455..865817 | - | 363 | WP_167823877.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
NLZ13_RS04175 (865893) | 865893..866114 | - | 222 | WP_000692323.1 | DUF987 domain-containing protein | - |
NLZ13_RS04180 (866177) | 866177..866653 | - | 477 | WP_123001450.1 | RadC family protein | - |
NLZ13_RS04185 (866669) | 866669..867154 | - | 486 | WP_112037803.1 | antirestriction protein | - |
NLZ13_RS04190 (867246) | 867246..868064 | - | 819 | WP_001234392.1 | DUF932 domain-containing protein | - |
NLZ13_RS04195 (868155) | 868155..868388 | - | 234 | WP_112037802.1 | DUF905 family protein | - |
NLZ13_RS04200 (868394) | 868394..869071 | - | 678 | WP_029490458.1 | hypothetical protein | - |
NLZ13_RS04205 (869190) | 869190..870074 | - | 885 | WP_254539366.1 | YfjP family GTPase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 14051.18 Da Isoelectric Point: 8.4983
>T250670 WP_000854831.1 NZ_CP100500:c865409-865035 [Escherichia coli]
MKTLPVLPKQAASSRPSPLEIWQILLTRLLDQHYGLTLHDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK
MKTLPVLPKQAASSRPSPLEIWQILLTRLLDQHYGLTLHDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK
Download Length: 375 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|