Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ataRT/DUF1778(antitoxin) |
Location | 367517..368317 | Replicon | chromosome |
Accession | NZ_CP100500 | ||
Organism | Escherichia coli strain LH50-c |
Toxin (Protein)
Gene name | ataT | Uniprot ID | U9Y257 |
Locus tag | NLZ13_RS01730 | Protein ID | WP_000342447.1 |
Coordinates | 367790..368317 (+) | Length | 176 a.a. |
Antitoxin (Protein)
Gene name | ataR | Uniprot ID | U9Y285 |
Locus tag | NLZ13_RS01725 | Protein ID | WP_001277109.1 |
Coordinates | 367517..367783 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NLZ13_RS01705 (363175) | 363175..363843 | + | 669 | WP_000617723.1 | cell division ATP-binding protein FtsE | - |
NLZ13_RS01710 (363836) | 363836..364894 | + | 1059 | WP_001042003.1 | permease-like cell division protein FtsX | - |
NLZ13_RS01715 (365139) | 365139..365993 | + | 855 | WP_000130217.1 | RNA polymerase sigma factor RpoH | - |
NLZ13_RS01720 (366264) | 366264..367367 | + | 1104 | WP_112037866.1 | branched chain amino acid ABC transporter substrate-binding protein LivJ | - |
NLZ13_RS01725 (367517) | 367517..367783 | + | 267 | WP_001277109.1 | type II toxin-antitoxin system antitoxin AtaR | Antitoxin |
NLZ13_RS01730 (367790) | 367790..368317 | + | 528 | WP_000342447.1 | type II toxin-antitoxin system toxin acetyltransferase AtaT | Toxin |
NLZ13_RS01735 (368314) | 368314..368697 | - | 384 | WP_000778769.1 | aspartate 1-decarboxylase autocleavage activator PanM | - |
NLZ13_RS01740 (369121) | 369121..370230 | + | 1110 | WP_001301528.1 | high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK | - |
NLZ13_RS01745 (370278) | 370278..371204 | + | 927 | WP_112037865.1 | high-affinity branched-chain amino acid ABC transporter permease LivH | - |
NLZ13_RS01750 (371201) | 371201..372478 | + | 1278 | WP_000803778.1 | branched chain amino acid ABC transporter permease LivM | - |
NLZ13_RS01755 (372475) | 372475..373242 | + | 768 | WP_000082101.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 176 a.a. Molecular weight: 19673.63 Da Isoelectric Point: 7.0284
>T250667 WP_000342447.1 NZ_CP100500:367790-368317 [Escherichia coli]
MDDLTIEILTDDADYDLQRFDCGEEALNLFLTTHLVRQHRNKILRAYILCRNTPERQVLGYYTLCGSCFERAALPSKSKQ
KKIPYKNIPSVTLGRLAIDHSIQGQGWGATLVAHAMKVVWSASLAVGIHGLFVEALNEKAHTFYKSLGFIPLVGENENAL
FFPTKSIELLFTQSD
MDDLTIEILTDDADYDLQRFDCGEEALNLFLTTHLVRQHRNKILRAYILCRNTPERQVLGYYTLCGSCFERAALPSKSKQ
KKIPYKNIPSVTLGRLAIDHSIQGQGWGATLVAHAMKVVWSASLAVGIHGLFVEALNEKAHTFYKSLGFIPLVGENENAL
FFPTKSIELLFTQSD
Download Length: 528 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9LUM2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9LUN0 |