Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
Location | 49621..50453 | Replicon | chromosome |
Accession | NZ_CP100500 | ||
Organism | Escherichia coli strain LH50-c |
Toxin (Protein)
Gene name | yeeV | Uniprot ID | - |
Locus tag | NLZ13_RS00255 | Protein ID | WP_112037996.1 |
Coordinates | 49621..49995 (-) | Length | 125 a.a. |
Antitoxin (Protein)
Gene name | yeeU | Uniprot ID | Q5I3J0 |
Locus tag | NLZ13_RS00260 | Protein ID | WP_001280951.1 |
Coordinates | 50085..50453 (-) | Length | 123 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NLZ13_RS00225 (44987) | 44987..45910 | - | 924 | WP_000535961.1 | carboxylate/amino acid/amine transporter | - |
NLZ13_RS00230 (46021) | 46021..47205 | - | 1185 | WP_001172864.1 | sugar efflux transporter | - |
NLZ13_RS00235 (47602) | 47602..47763 | - | 162 | Protein_46 | virulence RhuM family protein | - |
NLZ13_RS00240 (47997) | 47997..48842 | - | 846 | WP_001406222.1 | DUF4942 domain-containing protein | - |
NLZ13_RS00245 (48927) | 48927..49124 | - | 198 | WP_000839243.1 | DUF957 domain-containing protein | - |
NLZ13_RS00250 (49136) | 49136..49624 | - | 489 | WP_112037997.1 | DUF5983 family protein | - |
NLZ13_RS00255 (49621) | 49621..49995 | - | 375 | WP_112037996.1 | TA system toxin CbtA family protein | Toxin |
NLZ13_RS00260 (50085) | 50085..50453 | - | 369 | WP_001280951.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
NLZ13_RS00265 (50616) | 50616..50837 | - | 222 | WP_001405861.1 | DUF987 domain-containing protein | - |
NLZ13_RS00270 (50906) | 50906..51382 | - | 477 | WP_001186724.1 | RadC family protein | - |
NLZ13_RS00275 (51398) | 51398..51883 | - | 486 | WP_001469549.1 | antirestriction protein | - |
NLZ13_RS00280 (51979) | 51979..52797 | - | 819 | WP_112037995.1 | DUF932 domain-containing protein | - |
NLZ13_RS00285 (52897) | 52897..53130 | - | 234 | WP_094158925.1 | DUF905 family protein | - |
NLZ13_RS00290 (53209) | 53209..53664 | - | 456 | WP_000581504.1 | IrmA family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 14004.02 Da Isoelectric Point: 8.7453
>T250665 WP_112037996.1 NZ_CP100500:c49995-49621 [Escherichia coli]
MKTLPDTHVREASSCPSPVTIWQTLLSRLLGQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTNQPGF
STCPRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEKR
MKTLPDTHVREASSCPSPVTIWQTLLSRLLGQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTNQPGF
STCPRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEKR
Download Length: 375 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|