Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 50282..51018 | Replicon | plasmid pLH71-A |
| Accession | NZ_CP100498 | ||
| Organism | Klebsiella michiganensis strain LH71 | ||
Toxin (Protein)
| Gene name | tacT | Uniprot ID | A0A2J5Q928 |
| Locus tag | NLZ14_RS27820 | Protein ID | WP_004098919.1 |
| Coordinates | 50536..51018 (+) | Length | 161 a.a. |
Antitoxin (Protein)
| Gene name | tacA | Uniprot ID | A0A2J5Q9C0 |
| Locus tag | NLZ14_RS27815 | Protein ID | WP_004098921.1 |
| Coordinates | 50282..50548 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NLZ14_RS27785 (NLZ14_27785) | 45626..46201 | + | 576 | WP_044348232.1 | TerD family protein | - |
| NLZ14_RS27790 (NLZ14_27790) | 46289..47530 | + | 1242 | WP_047727579.1 | VWA domain-containing protein | - |
| NLZ14_RS27795 (NLZ14_27795) | 47558..48208 | - | 651 | WP_044348228.1 | HAD family hydrolase | - |
| NLZ14_RS27805 (NLZ14_27805) | 49613..49837 | + | 225 | WP_254540122.1 | hypothetical protein | - |
| NLZ14_RS27810 (NLZ14_27810) | 49881..50075 | - | 195 | WP_110188634.1 | hypothetical protein | - |
| NLZ14_RS27815 (NLZ14_27815) | 50282..50548 | + | 267 | WP_004098921.1 | DUF1778 domain-containing protein | Antitoxin |
| NLZ14_RS27820 (NLZ14_27820) | 50536..51018 | + | 483 | WP_004098919.1 | GNAT family N-acetyltransferase | Toxin |
| NLZ14_RS27825 (NLZ14_27825) | 51177..52697 | - | 1521 | WP_254540123.1 | IS3 family transposase | - |
| NLZ14_RS27830 (NLZ14_27830) | 52753..53201 | + | 449 | Protein_56 | IS1 family transposase | - |
| NLZ14_RS27835 (NLZ14_27835) | 53646..54215 | + | 570 | WP_254540124.1 | fimbrial protein | - |
| NLZ14_RS27840 (NLZ14_27840) | 54274..54969 | + | 696 | WP_254540125.1 | molecular chaperone | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | - | - | 1..125674 | 125674 | |
| - | inside | IScluster/Tn | - | - | 48428..53201 | 4773 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 161 a.a. Molecular weight: 17335.06 Da Isoelectric Point: 10.0704
>T250664 WP_004098919.1 NZ_CP100498:50536-51018 [Klebsiella michiganensis]
VGRITAPEPLSSAHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKKGTKKVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP
VGRITAPEPLSSAHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKKGTKKVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP
Download Length: 483 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2J5Q928 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2J5Q9C0 |