Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ataRT/ElaA-DUF1778 |
| Location | 20305..21056 | Replicon | plasmid pLH71-A |
| Accession | NZ_CP100498 | ||
| Organism | Klebsiella michiganensis strain LH71 | ||
Toxin (Protein)
| Gene name | ataT | Uniprot ID | - |
| Locus tag | NLZ14_RS27655 | Protein ID | WP_032694614.1 |
| Coordinates | 20574..21056 (+) | Length | 161 a.a. |
Antitoxin (Protein)
| Gene name | ataR | Uniprot ID | A0A071LPN3 |
| Locus tag | NLZ14_RS27650 | Protein ID | WP_004902250.1 |
| Coordinates | 20305..20583 (+) | Length | 93 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NLZ14_RS27620 (NLZ14_27620) | 15378..16667 | - | 1290 | WP_032694618.1 | arsenic transporter | - |
| NLZ14_RS27625 (NLZ14_27625) | 16714..18465 | - | 1752 | WP_032694617.1 | arsenical pump-driving ATPase | - |
| NLZ14_RS27630 (NLZ14_27630) | 18482..18844 | - | 363 | WP_254540129.1 | arsenite efflux transporter metallochaperone ArsD | - |
| NLZ14_RS27635 (NLZ14_27635) | 18892..19245 | - | 354 | WP_025376942.1 | As(III)-sensing metalloregulatory transcriptional repressor ArsR | - |
| NLZ14_RS27640 (NLZ14_27640) | 19549..19890 | + | 342 | WP_254540118.1 | hypothetical protein | - |
| NLZ14_RS27645 (NLZ14_27645) | 19961..20183 | + | 223 | Protein_19 | hypothetical protein | - |
| NLZ14_RS27650 (NLZ14_27650) | 20305..20583 | + | 279 | WP_004902250.1 | DUF1778 domain-containing protein | Antitoxin |
| NLZ14_RS27655 (NLZ14_27655) | 20574..21056 | + | 483 | WP_032694614.1 | GNAT family N-acetyltransferase | Toxin |
| NLZ14_RS27660 (NLZ14_27660) | 21412..21804 | - | 393 | WP_223239433.1 | hypothetical protein | - |
| NLZ14_RS27665 (NLZ14_27665) | 22035..22340 | + | 306 | WP_254540119.1 | hypothetical protein | - |
| NLZ14_RS27675 (NLZ14_27675) | 23513..24094 | + | 582 | Protein_25 | EcsC family protein | - |
| NLZ14_RS27680 (NLZ14_27680) | 24125..25858 | + | 1734 | WP_088168634.1 | DUF262 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | - | - | 1..125674 | 125674 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 161 a.a. Molecular weight: 17678.45 Da Isoelectric Point: 8.9130
>T250663 WP_032694614.1 NZ_CP100498:20574-21056 [Klebsiella michiganensis]
MGMRAPESLTAEHNIAEFCCQEPALNEWLKKKALRNHSTGISRVYVVCAENSNRVIGYYCLSSGSVHRNTVPGAYRRNAP
EVIPVIVLGRLAIDQAWSGNGLGAALLKDAIYRTQNIAFQVGVRALAVHALNEEVKCFYTRFGFEPSIVNTLTLLFPIKV
MGMRAPESLTAEHNIAEFCCQEPALNEWLKKKALRNHSTGISRVYVVCAENSNRVIGYYCLSSGSVHRNTVPGAYRRNAP
EVIPVIVLGRLAIDQAWSGNGLGAALLKDAIYRTQNIAFQVGVRALAVHALNEEVKCFYTRFGFEPSIVNTLTLLFPIKV
Download Length: 483 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|