Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | shpAB/BrnT-BrnA |
| Location | 5132234..5132810 | Replicon | chromosome |
| Accession | NZ_CP100497 | ||
| Organism | Klebsiella michiganensis strain LH71 | ||
Toxin (Protein)
| Gene name | shpA | Uniprot ID | - |
| Locus tag | NLZ14_RS24045 | Protein ID | WP_254540085.1 |
| Coordinates | 5132523..5132810 (-) | Length | 96 a.a. |
Antitoxin (Protein)
| Gene name | shpB | Uniprot ID | A0A0H3H591 |
| Locus tag | NLZ14_RS24040 | Protein ID | WP_014227757.1 |
| Coordinates | 5132234..5132536 (-) | Length | 101 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NLZ14_RS24025 (NLZ14_24025) | 5129070..5129405 | + | 336 | WP_064375703.1 | endoribonuclease SymE | - |
| NLZ14_RS24030 (NLZ14_24030) | 5129862..5130773 | + | 912 | WP_254539709.1 | acetamidase/formamidase family protein | - |
| NLZ14_RS24035 (NLZ14_24035) | 5130770..5132113 | + | 1344 | WP_148849614.1 | APC family permease | - |
| NLZ14_RS24040 (NLZ14_24040) | 5132234..5132536 | - | 303 | WP_014227757.1 | BrnA antitoxin family protein | Antitoxin |
| NLZ14_RS24045 (NLZ14_24045) | 5132523..5132810 | - | 288 | WP_254540085.1 | BrnT family toxin | Toxin |
| NLZ14_RS24050 (NLZ14_24050) | 5133070..5133513 | - | 444 | WP_064375701.1 | FosA family fosfomycin resistance glutathione transferase | - |
| NLZ14_RS24055 (NLZ14_24055) | 5133507..5134415 | - | 909 | WP_221842232.1 | LysR family transcriptional regulator | - |
| NLZ14_RS24060 (NLZ14_24060) | 5134503..5135285 | + | 783 | WP_049083709.1 | NAD(P)H-dependent oxidoreductase | - |
| NLZ14_RS24065 (NLZ14_24065) | 5135433..5136017 | + | 585 | WP_004098242.1 | TetR/AcrR family transcriptional regulator | - |
| NLZ14_RS24070 (NLZ14_24070) | 5136163..5136963 | + | 801 | WP_254539710.1 | winged helix-turn-helix domain-containing protein | - |
| NLZ14_RS24075 (NLZ14_24075) | 5136960..5137478 | + | 519 | WP_004098240.1 | FidL-like protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11226.69 Da Isoelectric Point: 7.4687
>T250662 WP_254540085.1 NZ_CP100497:c5132810-5132523 [Klebsiella michiganensis]
MPMEFEWDANKAISNLRKHGIRFEEAVLVFDDPRHLSRQDRYENGEYRWQTIGLVHGIIVIMVAHSVRFESGTEVIRIIS
ARKSDSKERNRYEHG
MPMEFEWDANKAISNLRKHGIRFEEAVLVFDDPRHLSRQDRYENGEYRWQTIGLVHGIIVIMVAHSVRFESGTEVIRIIS
ARKSDSKERNRYEHG
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|