Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 4463094..4463713 | Replicon | chromosome |
| Accession | NZ_CP100497 | ||
| Organism | Klebsiella michiganensis strain LH71 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | H3N9D8 |
| Locus tag | NLZ14_RS20970 | Protein ID | WP_004099646.1 |
| Coordinates | 4463495..4463713 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | - |
| Locus tag | NLZ14_RS20965 | Protein ID | WP_254539645.1 |
| Coordinates | 4463094..4463468 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NLZ14_RS20955 (NLZ14_20955) | 4458250..4459443 | + | 1194 | WP_004136054.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| NLZ14_RS20960 (NLZ14_20960) | 4459466..4462612 | + | 3147 | WP_014228207.1 | multidrug efflux RND transporter permease subunit AcrB | - |
| NLZ14_RS20965 (NLZ14_20965) | 4463094..4463468 | + | 375 | WP_254539645.1 | Hha toxicity modulator TomB | Antitoxin |
| NLZ14_RS20970 (NLZ14_20970) | 4463495..4463713 | + | 219 | WP_004099646.1 | HHA domain-containing protein | Toxin |
| NLZ14_RS20975 (NLZ14_20975) | 4463876..4464442 | + | 567 | WP_032748289.1 | maltose O-acetyltransferase | - |
| NLZ14_RS20980 (NLZ14_20980) | 4464414..4464548 | - | 135 | WP_223226764.1 | hypothetical protein | - |
| NLZ14_RS20985 (NLZ14_20985) | 4464569..4465039 | + | 471 | WP_004848329.1 | YlaC family protein | - |
| NLZ14_RS20990 (NLZ14_20990) | 4465014..4466468 | - | 1455 | WP_254540079.1 | PLP-dependent aminotransferase family protein | - |
| NLZ14_RS20995 (NLZ14_20995) | 4466570..4467268 | + | 699 | WP_254539646.1 | GNAT family protein | - |
| NLZ14_RS21000 (NLZ14_21000) | 4467265..4467405 | - | 141 | WP_003859006.1 | type B 50S ribosomal protein L36 | - |
| NLZ14_RS21005 (NLZ14_21005) | 4467405..4467668 | - | 264 | WP_004848323.1 | type B 50S ribosomal protein L31 | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8640.05 Da Isoelectric Point: 8.9008
>T250660 WP_004099646.1 NZ_CP100497:4463495-4463713 [Klebsiella michiganensis]
MSDKTLTKIDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPPSVWKFIR
MSDKTLTKIDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPPSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14394.20 Da Isoelectric Point: 4.8989
>AT250660 WP_254539645.1 NZ_CP100497:4463094-4463468 [Klebsiella michiganensis]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIAAFALNYKIKYAEDNKLITQIDEYL
DDTFVLFSNYGINSADLQKWRKSGNRLFRCFVNACRENPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIAAFALNYKIKYAEDNKLITQIDEYL
DDTFVLFSNYGINSADLQKWRKSGNRLFRCFVNACRENPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|