Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | pemIK/PRK09812-MazE |
| Location | 2007910..2008500 | Replicon | chromosome |
| Accession | NZ_CP100497 | ||
| Organism | Klebsiella michiganensis strain LH71 | ||
Toxin (Protein)
| Gene name | pemK | Uniprot ID | A0A0H3HDW1 |
| Locus tag | NLZ14_RS09535 | Protein ID | WP_014229979.1 |
| Coordinates | 2008168..2008500 (+) | Length | 111 a.a. |
Antitoxin (Protein)
| Gene name | pemI | Uniprot ID | J6I3K7 |
| Locus tag | NLZ14_RS09530 | Protein ID | WP_004852307.1 |
| Coordinates | 2007910..2008167 (+) | Length | 86 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NLZ14_RS09505 (NLZ14_09505) | 2003155..2003772 | - | 618 | WP_128334957.1 | glutathione S-transferase | - |
| NLZ14_RS09510 (NLZ14_09510) | 2003952..2004878 | + | 927 | WP_049101399.1 | LysR substrate-binding domain-containing protein | - |
| NLZ14_RS09515 (NLZ14_09515) | 2004916..2005914 | - | 999 | WP_148841994.1 | aldo/keto reductase | - |
| NLZ14_RS09520 (NLZ14_09520) | 2006015..2006929 | + | 915 | WP_025106070.1 | LysR family transcriptional regulator | - |
| NLZ14_RS09525 (NLZ14_09525) | 2007048..2007317 | - | 270 | WP_064391807.1 | hypothetical protein | - |
| NLZ14_RS09530 (NLZ14_09530) | 2007910..2008167 | + | 258 | WP_004852307.1 | antitoxin | Antitoxin |
| NLZ14_RS09535 (NLZ14_09535) | 2008168..2008500 | + | 333 | WP_014229979.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| NLZ14_RS09540 (NLZ14_09540) | 2008827..2010065 | + | 1239 | WP_254539943.1 | hypothetical protein | - |
| NLZ14_RS09545 (NLZ14_09545) | 2010235..2011959 | - | 1725 | WP_227634498.1 | response regulator receiver domain | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 111 a.a. Molecular weight: 11740.57 Da Isoelectric Point: 10.1863
>T250655 WP_014229979.1 NZ_CP100497:2008168-2008500 [Klebsiella michiganensis]
MDRGEIWLVSLDPIAGHEQSGKRPVLIVSKASFNKLTRLPVVVPITSGGNFARTAGFTVSLEGAGTKTTGVIRCDQPRTI
DMAARNGKRLESIPDAVVNEVLARLDAILS
MDRGEIWLVSLDPIAGHEQSGKRPVLIVSKASFNKLTRLPVVVPITSGGNFARTAGFTVSLEGAGTKTTGVIRCDQPRTI
DMAARNGKRLESIPDAVVNEVLARLDAILS
Download Length: 333 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3HDW1 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3HDW8 |