Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 897121..897778 | Replicon | chromosome |
| Accession | NZ_CP100497 | ||
| Organism | Klebsiella michiganensis strain LH71 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | J5U333 |
| Locus tag | NLZ14_RS04325 | Protein ID | WP_004854060.1 |
| Coordinates | 897368..897778 (+) | Length | 137 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | H3N295 |
| Locus tag | NLZ14_RS04320 | Protein ID | WP_004124953.1 |
| Coordinates | 897121..897387 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NLZ14_RS04305 (NLZ14_04305) | 892355..892780 | - | 426 | WP_004854067.1 | PTS sugar transporter subunit IIA | - |
| NLZ14_RS04310 (NLZ14_04310) | 892901..895699 | - | 2799 | WP_014226794.1 | transcriptional regulator DagR | - |
| NLZ14_RS04315 (NLZ14_04315) | 895893..896876 | - | 984 | WP_254539816.1 | tRNA-modifying protein YgfZ | - |
| NLZ14_RS04320 (NLZ14_04320) | 897121..897387 | + | 267 | WP_004124953.1 | FAD assembly factor SdhE | Antitoxin |
| NLZ14_RS04325 (NLZ14_04325) | 897368..897778 | + | 411 | WP_004854060.1 | protein YgfX | Toxin |
| NLZ14_RS04330 (NLZ14_04330) | 897787..898308 | - | 522 | WP_014226792.1 | flavodoxin FldB | - |
| NLZ14_RS04335 (NLZ14_04335) | 898430..899326 | + | 897 | WP_046876662.1 | site-specific tyrosine recombinase XerD | - |
| NLZ14_RS04340 (NLZ14_04340) | 899349..900062 | + | 714 | WP_004854054.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| NLZ14_RS04345 (NLZ14_04345) | 900068..901801 | + | 1734 | WP_032751182.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 16106.97 Da Isoelectric Point: 10.9455
>T250654 WP_004854060.1 NZ_CP100497:897368-897778 [Klebsiella michiganensis]
VVLWQSDLRISWRAQWFSLLMHGVVAALVLLMPWPLSYTPLWLILLSLVVFDCVRSQRRIHARQGEIKLLIDSRLRWQKA
EWDIIGTPWVINSGMLLRLRNTENQRTQHLWVAADSMDAGEWRDLRRLVLLKPTQE
VVLWQSDLRISWRAQWFSLLMHGVVAALVLLMPWPLSYTPLWLILLSLVVFDCVRSQRRIHARQGEIKLLIDSRLRWQKA
EWDIIGTPWVINSGMLLRLRNTENQRTQHLWVAADSMDAGEWRDLRRLVLLKPTQE
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GYA5 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3H3L9 |