Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | phd-doc/Doc-RelB |
| Location | 663575..664167 | Replicon | chromosome |
| Accession | NZ_CP100497 | ||
| Organism | Klebsiella michiganensis strain LH71 | ||
Toxin (Protein)
| Gene name | doc | Uniprot ID | A0A7H4PHG5 |
| Locus tag | NLZ14_RS03225 | Protein ID | WP_004105955.1 |
| Coordinates | 663793..664167 (+) | Length | 125 a.a. |
Antitoxin (Protein)
| Gene name | phd | Uniprot ID | A0A2J4YM08 |
| Locus tag | NLZ14_RS03220 | Protein ID | WP_004105957.1 |
| Coordinates | 663575..663796 (+) | Length | 74 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NLZ14_RS03200 (NLZ14_03200) | 659132..659686 | + | 555 | WP_254539797.1 | YgjV family protein | - |
| NLZ14_RS03205 (NLZ14_03205) | 659705..660952 | - | 1248 | WP_004105963.1 | serine/threonine transporter SstT | - |
| NLZ14_RS03210 (NLZ14_03210) | 661207..662175 | - | 969 | WP_181251403.1 | TerC family protein | - |
| NLZ14_RS03215 (NLZ14_03215) | 662426..663415 | - | 990 | WP_049071572.1 | Gfo/Idh/MocA family oxidoreductase | - |
| NLZ14_RS03220 (NLZ14_03220) | 663575..663796 | + | 222 | WP_004105957.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | Antitoxin |
| NLZ14_RS03225 (NLZ14_03225) | 663793..664167 | + | 375 | WP_004105955.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
| NLZ14_RS03230 (NLZ14_03230) | 664147..664650 | - | 504 | WP_254539798.1 | M48 family metallopeptidase | - |
| NLZ14_RS03235 (NLZ14_03235) | 664729..666372 | - | 1644 | WP_254539799.1 | glycoside hydrolase family 43 protein | - |
| NLZ14_RS03240 (NLZ14_03240) | 666501..667367 | - | 867 | WP_038423701.1 | AraC family transcriptional regulator | - |
| NLZ14_RS03245 (NLZ14_03245) | 667475..668818 | + | 1344 | WP_046878299.1 | glycoside-pentoside-hexuronide (GPH):cation symporter | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 13895.93 Da Isoelectric Point: 6.0769
>T250653 WP_004105955.1 NZ_CP100497:663793-664167 [Klebsiella michiganensis]
MKWVSASEVIAFHDRILQHLPGVKGMSDPGRAEAIIYRVQNRFHYEGVNDIFELAATYWVAIARGHIFNDGNKRTAFFIT
MTFLARNGYLIADEDTRLEELTVLAATGEATVVVLADALRQLAL
MKWVSASEVIAFHDRILQHLPGVKGMSDPGRAEAIIYRVQNRFHYEGVNDIFELAATYWVAIARGHIFNDGNKRTAFFIT
MTFLARNGYLIADEDTRLEELTVLAATGEATVVVLADALRQLAL
Download Length: 375 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7H4PHG5 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2J4YM08 |