Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
Location | 56959..57506 | Replicon | chromosome |
Accession | NZ_CP100497 | ||
Organism | Klebsiella michiganensis strain LH71 |
Toxin (Protein)
Gene name | ccdB | Uniprot ID | A0A0H3H5T3 |
Locus tag | NLZ14_RS00290 | Protein ID | WP_014227299.1 |
Coordinates | 56959..57267 (-) | Length | 103 a.a. |
Antitoxin (Protein)
Gene name | ccdA | Uniprot ID | A0A0H3H0P7 |
Locus tag | NLZ14_RS00295 | Protein ID | WP_014227298.1 |
Coordinates | 57270..57506 (-) | Length | 79 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NLZ14_RS00260 (NLZ14_00260) | 52606..52917 | - | 312 | WP_014227304.1 | PTS sugar transporter subunit IIB | - |
NLZ14_RS00265 (NLZ14_00265) | 53212..54153 | + | 942 | WP_014227303.1 | LacI family DNA-binding transcriptional regulator | - |
NLZ14_RS00270 (NLZ14_00270) | 54177..54470 | - | 294 | WP_014227302.1 | YicS family protein | - |
NLZ14_RS00275 (NLZ14_00275) | 54680..55645 | + | 966 | WP_064377595.1 | Rpn family recombination-promoting nuclease/putative transposase | - |
NLZ14_RS00280 (NLZ14_00280) | 55645..55902 | + | 258 | WP_032718834.1 | hypothetical protein | - |
NLZ14_RS00285 (NLZ14_00285) | 55906..56808 | - | 903 | WP_014227300.1 | EamA family transporter | - |
NLZ14_RS00290 (NLZ14_00290) | 56959..57267 | - | 309 | WP_014227299.1 | CcdB family protein | Toxin |
NLZ14_RS00295 (NLZ14_00295) | 57270..57506 | - | 237 | WP_014227298.1 | type II toxin-antitoxin system CcdA family antitoxin | Antitoxin |
NLZ14_RS00300 (NLZ14_00300) | 57612..59045 | - | 1434 | WP_048262922.1 | PTS N-acetylmuramic acid transporter subunit IIBC | - |
NLZ14_RS00305 (NLZ14_00305) | 59070..59972 | - | 903 | WP_032752002.1 | N-acetylmuramic acid 6-phosphate etherase | - |
NLZ14_RS00310 (NLZ14_00310) | 60133..61299 | - | 1167 | WP_014227296.1 | multidrug effflux MFS transporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 103 a.a. Molecular weight: 11725.57 Da Isoelectric Point: 7.2729
>T250652 WP_014227299.1 NZ_CP100497:c57267-56959 [Klebsiella michiganensis]
MQYYVYKNTGRIAAYPYLLDVQSDIIGKRNTRVVIPLFPLKNYKGPRADRLTPLVTVEGEEYVVMTHELASIPHRVLGEE
VCNLNHQREVVKASMDFLFDGI
MQYYVYKNTGRIAAYPYLLDVQSDIIGKRNTRVVIPLFPLKNYKGPRADRLTPLVTVEGEEYVVMTHELASIPHRVLGEE
VCNLNHQREVVKASMDFLFDGI
Download Length: 309 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3H5T3 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3H0P7 |