Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | ykfI-yfjZ/CbtA-CbeA |
Location | 3660131..3660810 | Replicon | chromosome |
Accession | NZ_CP100494 | ||
Organism | Atlantibacter subterranea strain LH84-a |
Toxin (Protein)
Gene name | ykfI | Uniprot ID | - |
Locus tag | NLZ15_RS17225 | Protein ID | WP_254486853.1 |
Coordinates | 3660469..3660810 (+) | Length | 114 a.a. |
Antitoxin (Protein)
Gene name | yfjZ | Uniprot ID | - |
Locus tag | NLZ15_RS17220 | Protein ID | WP_254486851.1 |
Coordinates | 3660131..3660448 (+) | Length | 106 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NLZ15_RS17190 (NLZ15_17190) | 3655294..3655887 | - | 594 | WP_254486843.1 | hypothetical protein | - |
NLZ15_RS17195 (NLZ15_17195) | 3655891..3657405 | - | 1515 | WP_254486845.1 | RNA-directed DNA polymerase | - |
NLZ15_RS17200 (NLZ15_17200) | 3657941..3658213 | - | 273 | WP_254486847.1 | ogr/Delta-like zinc finger family protein | - |
NLZ15_RS17205 (NLZ15_17205) | 3658494..3658697 | - | 204 | WP_254486849.1 | helicase | - |
NLZ15_RS17210 (NLZ15_17210) | 3658723..3659935 | + | 1213 | Protein_3372 | IS3 family transposase | - |
NLZ15_RS17215 (NLZ15_17215) | 3659951..3660112 | + | 162 | WP_254489052.1 | DUF987 family protein | - |
NLZ15_RS17220 (NLZ15_17220) | 3660131..3660448 | + | 318 | WP_254486851.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
NLZ15_RS17225 (NLZ15_17225) | 3660469..3660810 | + | 342 | WP_254486853.1 | TA system toxin CbtA family protein | Toxin |
NLZ15_RS17230 (NLZ15_17230) | 3661372..3661694 | - | 323 | Protein_3376 | hypothetical protein | - |
NLZ15_RS17235 (NLZ15_17235) | 3661776..3663188 | - | 1413 | WP_254486855.1 | phage tail protein | - |
NLZ15_RS17240 (NLZ15_17240) | 3663245..3663877 | - | 633 | WP_254486857.1 | hypothetical protein | - |
NLZ15_RS17245 (NLZ15_17245) | 3663874..3664143 | - | 270 | WP_254486859.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 3646655..3710384 | 63729 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12878.93 Da Isoelectric Point: 9.6836
>T250650 WP_254486853.1 NZ_CP100494:3660469-3660810 [Atlantibacter subterranea]
MKLQPAATSRAVKPCLSPVAVWQMLLTRLLEQHYGLTLNDTPFSDETVIQKHIDAGITLINAVNFLVEKYELVRIDRRGF
SWQEQSPYLRAVDILRARQATGLLRQSCNNAVR
MKLQPAATSRAVKPCLSPVAVWQMLLTRLLEQHYGLTLNDTPFSDETVIQKHIDAGITLINAVNFLVEKYELVRIDRRGF
SWQEQSPYLRAVDILRARQATGLLRQSCNNAVR
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|