Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3484027..3484648 | Replicon | chromosome |
| Accession | NZ_CP100494 | ||
| Organism | Atlantibacter subterranea strain LH84-a | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | A0A3R9FT17 |
| Locus tag | NLZ15_RS16385 | Protein ID | WP_059040068.1 |
| Coordinates | 3484430..3484648 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | - |
| Locus tag | NLZ15_RS16380 | Protein ID | WP_125294098.1 |
| Coordinates | 3484027..3484401 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NLZ15_RS16370 (NLZ15_16370) | 3479188..3480384 | + | 1197 | WP_125294100.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| NLZ15_RS16375 (NLZ15_16375) | 3480407..3483556 | + | 3150 | WP_125294099.1 | multidrug efflux RND transporter permease subunit AcrB | - |
| NLZ15_RS16380 (NLZ15_16380) | 3484027..3484401 | + | 375 | WP_125294098.1 | Hha toxicity modulator TomB | Antitoxin |
| NLZ15_RS16385 (NLZ15_16385) | 3484430..3484648 | + | 219 | WP_059040068.1 | HHA domain-containing protein | Toxin |
| NLZ15_RS16390 (NLZ15_16390) | 3485087..3485557 | + | 471 | WP_125294097.1 | YlaC family protein | - |
| NLZ15_RS16395 (NLZ15_16395) | 3485594..3485734 | - | 141 | WP_125294096.1 | type B 50S ribosomal protein L36 | - |
| NLZ15_RS16400 (NLZ15_16400) | 3485737..3485997 | - | 261 | WP_254486728.1 | type B 50S ribosomal protein L31 | - |
| NLZ15_RS16405 (NLZ15_16405) | 3486241..3487818 | + | 1578 | WP_254486730.1 | EAL domain-containing protein | - |
| NLZ15_RS16410 (NLZ15_16410) | 3487826..3488179 | - | 354 | WP_254486732.1 | DUF1428 family protein | - |
| NLZ15_RS16415 (NLZ15_16415) | 3488376..3488594 | - | 219 | WP_254486734.1 | hypothetical protein | - |
| NLZ15_RS16420 (NLZ15_16420) | 3488591..3488842 | - | 252 | WP_125294092.1 | hypothetical protein | - |
| NLZ15_RS16430 (NLZ15_16430) | 3489292..3489612 | + | 321 | WP_125294158.1 | MGMT family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8640.05 Da Isoelectric Point: 8.9008
>T250648 WP_059040068.1 NZ_CP100494:3484430-3484648 [Atlantibacter subterranea]
MSEKPLTKIDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKIDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14341.12 Da Isoelectric Point: 4.6864
>AT250648 WP_125294098.1 NZ_CP100494:3484027-3484401 [Atlantibacter subterranea]
MDEYSPKRHDIAQLKFLCENLYHDCLATLGDSNHGWVNDPTSAINLQLNELIEHIASFALNYKIKYDEDNALIEQIDEYL
DDTFMLFSNYGISAQDLQKWRKSGNRLFKCFVNVSKANPVSLSF
MDEYSPKRHDIAQLKFLCENLYHDCLATLGDSNHGWVNDPTSAINLQLNELIEHIASFALNYKIKYDEDNALIEQIDEYL
DDTFMLFSNYGISAQDLQKWRKSGNRLFKCFVNVSKANPVSLSF
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|