Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 3484027..3484648 Replicon chromosome
Accession NZ_CP100494
Organism Atlantibacter subterranea strain LH84-a

Toxin (Protein)


Gene name Hha Uniprot ID A0A3R9FT17
Locus tag NLZ15_RS16385 Protein ID WP_059040068.1
Coordinates 3484430..3484648 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID -
Locus tag NLZ15_RS16380 Protein ID WP_125294098.1
Coordinates 3484027..3484401 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NLZ15_RS16370 (NLZ15_16370) 3479188..3480384 + 1197 WP_125294100.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
NLZ15_RS16375 (NLZ15_16375) 3480407..3483556 + 3150 WP_125294099.1 multidrug efflux RND transporter permease subunit AcrB -
NLZ15_RS16380 (NLZ15_16380) 3484027..3484401 + 375 WP_125294098.1 Hha toxicity modulator TomB Antitoxin
NLZ15_RS16385 (NLZ15_16385) 3484430..3484648 + 219 WP_059040068.1 HHA domain-containing protein Toxin
NLZ15_RS16390 (NLZ15_16390) 3485087..3485557 + 471 WP_125294097.1 YlaC family protein -
NLZ15_RS16395 (NLZ15_16395) 3485594..3485734 - 141 WP_125294096.1 type B 50S ribosomal protein L36 -
NLZ15_RS16400 (NLZ15_16400) 3485737..3485997 - 261 WP_254486728.1 type B 50S ribosomal protein L31 -
NLZ15_RS16405 (NLZ15_16405) 3486241..3487818 + 1578 WP_254486730.1 EAL domain-containing protein -
NLZ15_RS16410 (NLZ15_16410) 3487826..3488179 - 354 WP_254486732.1 DUF1428 family protein -
NLZ15_RS16415 (NLZ15_16415) 3488376..3488594 - 219 WP_254486734.1 hypothetical protein -
NLZ15_RS16420 (NLZ15_16420) 3488591..3488842 - 252 WP_125294092.1 hypothetical protein -
NLZ15_RS16430 (NLZ15_16430) 3489292..3489612 + 321 WP_125294158.1 MGMT family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8640.05 Da        Isoelectric Point: 8.9008

>T250648 WP_059040068.1 NZ_CP100494:3484430-3484648 [Atlantibacter subterranea]
MSEKPLTKIDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14341.12 Da        Isoelectric Point: 4.6864

>AT250648 WP_125294098.1 NZ_CP100494:3484027-3484401 [Atlantibacter subterranea]
MDEYSPKRHDIAQLKFLCENLYHDCLATLGDSNHGWVNDPTSAINLQLNELIEHIASFALNYKIKYDEDNALIEQIDEYL
DDTFMLFSNYGISAQDLQKWRKSGNRLFKCFVNVSKANPVSLSF

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A3R9FT17

Antitoxin

Source ID Structure

References