Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | pemIK/PRK09812-MazE |
| Location | 1718587..1719177 | Replicon | chromosome |
| Accession | NZ_CP100494 | ||
| Organism | Atlantibacter subterranea strain LH84-a | ||
Toxin (Protein)
| Gene name | pemK | Uniprot ID | - |
| Locus tag | NLZ15_RS08085 | Protein ID | WP_125292343.1 |
| Coordinates | 1718845..1719177 (+) | Length | 111 a.a. |
Antitoxin (Protein)
| Gene name | pemI | Uniprot ID | - |
| Locus tag | NLZ15_RS08080 | Protein ID | WP_125292508.1 |
| Coordinates | 1718587..1718844 (+) | Length | 86 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NLZ15_RS08055 (NLZ15_08055) | 1714022..1714882 | - | 861 | WP_254488186.1 | metal ABC transporter permease | - |
| NLZ15_RS08060 (NLZ15_08060) | 1714879..1715679 | - | 801 | WP_254488188.1 | manganese/iron ABC transporter ATP-binding protein | - |
| NLZ15_RS08065 (NLZ15_08065) | 1715676..1716560 | - | 885 | WP_254488976.1 | metal ABC transporter substrate-binding protein | - |
| NLZ15_RS08070 (NLZ15_08070) | 1716833..1717765 | + | 933 | WP_254488190.1 | L,D-transpeptidase | - |
| NLZ15_RS08075 (NLZ15_08075) | 1717897..1718373 | + | 477 | WP_254488192.1 | hypothetical protein | - |
| NLZ15_RS08080 (NLZ15_08080) | 1718587..1718844 | + | 258 | WP_125292508.1 | antitoxin | Antitoxin |
| NLZ15_RS08085 (NLZ15_08085) | 1718845..1719177 | + | 333 | WP_125292343.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| NLZ15_RS08095 (NLZ15_08095) | 1719473..1720927 | - | 1455 | WP_125292307.1 | AMP nucleosidase | - |
| NLZ15_RS08100 (NLZ15_08100) | 1721324..1722439 | + | 1116 | WP_144129118.1 | branched-chain amino acid ABC transporter substrate-binding protein | - |
| NLZ15_RS08105 (NLZ15_08105) | 1722535..1723449 | + | 915 | WP_125292305.1 | branched-chain amino acid ABC transporter permease LivH | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 111 a.a. Molecular weight: 11839.66 Da Isoelectric Point: 10.2966
>T250642 WP_125292343.1 NZ_CP100494:1718845-1719177 [Atlantibacter subterranea]
MDRGEIWLVSLDPTAGHEQSGKRPVLIVSKASFNTFTRLPVVVPVTSGGHFARAAGFTVSLDGAGTKTTGVIRCDQPRTI
DMVARSGKRLERIPEAIVNEVLARLEAILN
MDRGEIWLVSLDPTAGHEQSGKRPVLIVSKASFNTFTRLPVVVPVTSGGHFARAAGFTVSLDGAGTKTTGVIRCDQPRTI
DMVARSGKRLERIPEAIVNEVLARLEAILN
Download Length: 333 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|