Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 784235..784901 | Replicon | chromosome |
Accession | NZ_CP100494 | ||
Organism | Atlantibacter subterranea strain LH84-a |
Toxin (Protein)
Gene name | cptA | Uniprot ID | - |
Locus tag | NLZ15_RS03755 | Protein ID | WP_151602299.1 |
Coordinates | 784482..784901 (+) | Length | 140 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | - |
Locus tag | NLZ15_RS03750 | Protein ID | WP_125295342.1 |
Coordinates | 784235..784501 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NLZ15_RS03725 (NLZ15_03725) | 779447..780880 | - | 1434 | WP_125295346.1 | 6-phospho-beta-glucosidase | - |
NLZ15_RS03730 (NLZ15_03730) | 781004..781741 | - | 738 | WP_192798679.1 | MurR/RpiR family transcriptional regulator | - |
NLZ15_RS03735 (NLZ15_03735) | 781855..782166 | + | 312 | WP_220266523.1 | N(4)-acetylcytidine aminohydrolase | - |
NLZ15_RS03740 (NLZ15_03740) | 782296..782955 | + | 660 | WP_125295344.1 | hemolysin III family protein | - |
NLZ15_RS03745 (NLZ15_03745) | 782990..783976 | - | 987 | WP_254487737.1 | tRNA-modifying protein YgfZ | - |
NLZ15_RS03750 (NLZ15_03750) | 784235..784501 | + | 267 | WP_125295342.1 | FAD assembly factor SdhE | Antitoxin |
NLZ15_RS03755 (NLZ15_03755) | 784482..784901 | + | 420 | WP_151602299.1 | protein YgfX | Toxin |
NLZ15_RS03760 (NLZ15_03760) | 784906..785427 | - | 522 | WP_254487738.1 | flavodoxin FldB | - |
NLZ15_RS03765 (NLZ15_03765) | 785529..786428 | + | 900 | WP_254488883.1 | site-specific tyrosine recombinase XerD | - |
NLZ15_RS03770 (NLZ15_03770) | 786454..787167 | + | 714 | WP_125295339.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
NLZ15_RS03775 (NLZ15_03775) | 787171..788904 | + | 1734 | WP_254487739.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 140 a.a. Molecular weight: 16352.25 Da Isoelectric Point: 11.0916
>T250641 WP_151602299.1 NZ_CP100494:784482-784901 [Atlantibacter subterranea]
VVLWQSDLRVSWRAQWFSLMLHGIVAAVILLLPWPLSYMPVWLVLLSLVVFDCVRSQRRIHSLQGEVKLTMDYRLRWQGV
EWELIGAPWMLQSGMLLRLRHPGTQRSQHLWLAADSMDASEWRDLRRVLLQQPQSGRPS
VVLWQSDLRVSWRAQWFSLMLHGIVAAVILLLPWPLSYMPVWLVLLSLVVFDCVRSQRRIHSLQGEVKLTMDYRLRWQGV
EWELIGAPWMLQSGMLLRLRHPGTQRSQHLWLAADSMDASEWRDLRRVLLQQPQSGRPS
Download Length: 420 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|