Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
| Location | 75738..76288 | Replicon | chromosome |
| Accession | NZ_CP100494 | ||
| Organism | Atlantibacter subterranea strain LH84-a | ||
Toxin (Protein)
| Gene name | ccdB | Uniprot ID | - |
| Locus tag | NLZ15_RS00380 | Protein ID | WP_125292944.1 |
| Coordinates | 75977..76288 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | ccdA | Uniprot ID | - |
| Locus tag | NLZ15_RS00375 | Protein ID | WP_125292827.1 |
| Coordinates | 75738..75974 (+) | Length | 79 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NLZ15_RS00355 (NLZ15_00355) | 71289..72323 | - | 1035 | WP_125292831.1 | L-rhamnose/proton symporter RhaT | - |
| NLZ15_RS00360 (NLZ15_00360) | 72522..73943 | - | 1422 | WP_254487481.1 | L-fucose/L-arabinose isomerase family protein | - |
| NLZ15_RS00365 (NLZ15_00365) | 74230..74850 | + | 621 | WP_144131890.1 | superoxide dismutase [Mn] | - |
| NLZ15_RS00370 (NLZ15_00370) | 74920..75609 | + | 690 | WP_254487482.1 | 6-hydroxyaminopurine reductase | - |
| NLZ15_RS00375 (NLZ15_00375) | 75738..75974 | + | 237 | WP_125292827.1 | type II toxin-antitoxin system CcdA family antitoxin | Antitoxin |
| NLZ15_RS00380 (NLZ15_00380) | 75977..76288 | + | 312 | WP_125292944.1 | CcdB family protein | Toxin |
| NLZ15_RS00385 (NLZ15_00385) | 76327..77535 | - | 1209 | WP_254489090.1 | FMN-dependent L-lactate dehydrogenase LldD | - |
| NLZ15_RS00390 (NLZ15_00390) | 77535..78317 | - | 783 | WP_125292826.1 | transcriptional regulator LldR | - |
| NLZ15_RS00395 (NLZ15_00395) | 78314..79969 | - | 1656 | WP_125292825.1 | L-lactate permease | - |
| NLZ15_RS00400 (NLZ15_00400) | 80308..80670 | - | 363 | WP_125292824.1 | YibL family ribosome-associated protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 11526.58 Da Isoelectric Point: 6.9759
>T250639 WP_125292944.1 NZ_CP100494:75977-76288 [Atlantibacter subterranea]
MQFTVYKNTGRMALYPYVLNVQSDIIGRRTTRIVIPLFPLEKYMGPLADRLTPIVTVGPEKFVLMTHELASIPEKALGEE
ICSITSQRDVIKSALDFLLDGIG
MQFTVYKNTGRMALYPYVLNVQSDIIGRRTTRIVIPLFPLEKYMGPLADRLTPIVTVGPEKFVLMTHELASIPEKALGEE
ICSITSQRDVIKSALDFLLDGIG
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|