Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-Phd
Location 55379..55980 Replicon plasmid pLH85-a-A
Accession NZ_CP100487
Organism Escherichia coli strain LH85-a

Toxin (Protein)


Gene name doc Uniprot ID -
Locus tag NLZ16_RS24730 Protein ID WP_254521323.1
Coordinates 55600..55980 (+) Length 127 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID U9YQH9
Locus tag NLZ16_RS24725 Protein ID WP_001190712.1
Coordinates 55379..55600 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NLZ16_RS24670 (NLZ16_24665) 50463..50723 + 261 Protein_59 hypothetical protein -
NLZ16_RS24675 (NLZ16_24670) 51138..51305 + 168 WP_233042539.1 hypothetical protein -
NLZ16_RS24680 (NLZ16_24675) 51388..51621 + 234 WP_089667679.1 hypothetical protein -
NLZ16_RS24685 (NLZ16_24680) 51800..52093 + 294 WP_000269001.1 hypothetical protein -
NLZ16_RS24690 (NLZ16_24685) 52100..52474 + 375 WP_032353387.1 hypothetical protein -
NLZ16_RS24695 (NLZ16_24690) 52456..53229 + 774 WP_223677252.1 hypothetical protein -
NLZ16_RS24700 (NLZ16_24695) 53275..53541 + 267 WP_023356287.1 hypothetical protein -
NLZ16_RS24705 (NLZ16_24700) 53544..53783 + 240 WP_023356286.1 DNA polymerase III subunit theta -
NLZ16_RS24710 (NLZ16_24705) 53795..54157 - 363 WP_042102765.1 hypothetical protein -
NLZ16_RS24715 (NLZ16_24710) 54158..54742 - 585 WP_023356284.1 hypothetical protein -
NLZ16_RS24720 (NLZ16_24715) 54917..55306 + 390 WP_000506730.1 S24 family peptidase -
NLZ16_RS24725 (NLZ16_24720) 55379..55600 + 222 WP_001190712.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
NLZ16_RS24730 (NLZ16_24725) 55600..55980 + 381 WP_254521323.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
NLZ16_RS24735 (NLZ16_24730) 55985..56164 + 180 WP_000113018.1 hypothetical protein -
NLZ16_RS24740 (NLZ16_24735) 56192..57235 + 1044 WP_254521324.1 DUF968 domain-containing protein -
NLZ16_RS24745 (NLZ16_24740) 57324..57776 + 453 WP_001326849.1 late promoter-activating protein -
NLZ16_RS24750 (NLZ16_24745) 57862..59055 + 1194 WP_254521325.1 terminase -
NLZ16_RS24755 (NLZ16_24750) 59055..60539 + 1485 WP_000124159.1 hypothetical protein -
NLZ16_RS24760 (NLZ16_24755) 60753..60854 + 102 Protein_77 transcriptional regulator -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..95326 95326


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(4-84)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-51)


Sequences

Toxin        


Download         Length: 127 a.a.        Molecular weight: 13586.37 Da        Isoelectric Point: 5.6343

>T250633 WP_254521323.1 NZ_CP100487:55600-55980 [Escherichia coli]
MRHISPEELIALHDANISRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELVDLTVGAATGEISVSTVAATLRRLYGSAE

Download         Length: 381 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8133.10 Da        Isoelectric Point: 4.7708

>AT250633 WP_001190712.1 NZ_CP100487:55379-55600 [Escherichia coli]
MQSINFRTARGNLSEVLNNVEAGEEVEITRRGREPAVIVSKATFEAYKKAALDAEFASLFDTLDSTNKELVNR

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A829CJB6

References