Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 4527258..4528093 | Replicon | chromosome |
| Accession | NZ_CP100486 | ||
| Organism | Escherichia coli strain LH85-a | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | - |
| Locus tag | NLZ16_RS21585 | Protein ID | WP_057109034.1 |
| Coordinates | 4527716..4528093 (+) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | - |
| Locus tag | NLZ16_RS21580 | Protein ID | WP_088569162.1 |
| Coordinates | 4527258..4527626 (+) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NLZ16_RS21540 (4522439) | 4522439..4523323 | + | 885 | WP_023563932.1 | 50S ribosome-binding GTPase | - |
| NLZ16_RS21545 (4523442) | 4523442..4524131 | + | 690 | WP_109475807.1 | hypothetical protein | - |
| NLZ16_RS21550 (4524137) | 4524137..4524289 | + | 153 | WP_001696589.1 | DUF905 family protein | - |
| NLZ16_RS21555 (4524390) | 4524390..4525208 | + | 819 | WP_001234688.1 | DUF932 domain-containing protein | - |
| NLZ16_RS21560 (4525290) | 4525290..4525769 | + | 480 | WP_000860074.1 | antirestriction protein | - |
| NLZ16_RS21565 (4525785) | 4525785..4526261 | + | 477 | WP_001366830.1 | RadC family protein | - |
| NLZ16_RS21570 (4526324) | 4526324..4526545 | + | 222 | WP_000692323.1 | DUF987 domain-containing protein | - |
| NLZ16_RS21575 (4526564) | 4526564..4527208 | + | 645 | WP_252713935.1 | antitoxin of toxin-antitoxin stability system | - |
| NLZ16_RS21580 (4527258) | 4527258..4527626 | + | 369 | WP_088569162.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| NLZ16_RS21585 (4527716) | 4527716..4528093 | + | 378 | WP_057109034.1 | TA system toxin CbtA family protein | Toxin |
| NLZ16_RS21590 (4528090) | 4528090..4528239 | + | 150 | Protein_4226 | DUF5983 family protein | - |
| NLZ16_RS21595 (4528315) | 4528315..4528512 | + | 198 | WP_023563519.1 | DUF957 domain-containing protein | - |
| NLZ16_RS21600 (4528597) | 4528597..4529439 | + | 843 | WP_072693117.1 | DUF4942 domain-containing protein | - |
| NLZ16_RS21605 (4530188) | 4530188..4531726 | + | 1539 | WP_001187178.1 | lysine decarboxylation/transport transcriptional activator CadC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 4504420..4539539 | 35119 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 13934.86 Da Isoelectric Point: 6.8517
>T250630 WP_057109034.1 NZ_CP100486:4527716-4528093 [Escherichia coli]
MKTLPDTHVREASCCPSPVTIWQTLLTRLLDQHYGLALNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGASSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEAKQ
MKTLPDTHVREASCCPSPVTIWQTLLTRLLDQHYGLALNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGASSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEAKQ
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13754.55 Da Isoelectric Point: 6.8270
>AT250630 WP_088569162.1 NZ_CP100486:4527258-4527626 [Escherichia coli]
VSDTLPGTTHHDDNHDRLWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYHPDQTFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
VSDTLPGTTHHDDNHDRLWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYHPDQTFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|