Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | chpSB/PRK09812-ChpS |
| Location | 4396464..4397059 | Replicon | chromosome |
| Accession | NZ_CP100486 | ||
| Organism | Escherichia coli strain LH85-a | ||
Toxin (Protein)
| Gene name | chpB | Uniprot ID | A0A0V9NWK6 |
| Locus tag | NLZ16_RS20880 | Protein ID | WP_019842229.1 |
| Coordinates | 4396464..4396814 (-) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | chpS | Uniprot ID | L4JJX7 |
| Locus tag | NLZ16_RS20885 | Protein ID | WP_001223213.1 |
| Coordinates | 4396808..4397059 (-) | Length | 84 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NLZ16_RS20860 (4391794) | 4391794..4392816 | - | 1023 | WP_001550507.1 | ABC transporter permease | - |
| NLZ16_RS20865 (4392830) | 4392830..4394332 | - | 1503 | WP_001550506.1 | sugar ABC transporter ATP-binding protein | - |
| NLZ16_RS20870 (4394464) | 4394464..4395420 | - | 957 | WP_000265933.1 | galactofuranose ABC transporter substrate-binding protein YtfQ | - |
| NLZ16_RS20875 (4395730) | 4395730..4396260 | + | 531 | WP_000055075.1 | inorganic diphosphatase | - |
| NLZ16_RS20880 (4396464) | 4396464..4396814 | - | 351 | WP_019842229.1 | endoribonuclease toxin ChpB | Toxin |
| NLZ16_RS20885 (4396808) | 4396808..4397059 | - | 252 | WP_001223213.1 | type II toxin-antitoxin system antitoxin ChpS | Antitoxin |
| NLZ16_RS20890 (4397271) | 4397271..4397612 | - | 342 | WP_001550504.1 | gamma-glutamylcyclotransferase | - |
| NLZ16_RS20895 (4397615) | 4397615..4401394 | - | 3780 | WP_001596432.1 | autotransporter assembly complex protein TamB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12483.44 Da Isoelectric Point: 5.6097
>T250629 WP_019842229.1 NZ_CP100486:c4396814-4396464 [Escherichia coli]
MVKKSEFERGDIVLVGFDPASGHEQQGAGRPALVLSVQAFNQLGMTLVAPITQGGNFARYAGFSVPLHCEEGDVHGVVLV
NQVWMMDLRARLAKRIGLAAGEVVEEALLRLQAVVE
MVKKSEFERGDIVLVGFDPASGHEQQGAGRPALVLSVQAFNQLGMTLVAPITQGGNFARYAGFSVPLHCEEGDVHGVVLV
NQVWMMDLRARLAKRIGLAAGEVVEEALLRLQAVVE
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0V9NWK6 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | L4JJX7 |