Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3708412..3709030 | Replicon | chromosome |
| Accession | NZ_CP100486 | ||
| Organism | Escherichia coli strain LH85-a | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | H5UYE2 |
| Locus tag | NLZ16_RS17700 | Protein ID | WP_001291435.1 |
| Coordinates | 3708812..3709030 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | S1PTH5 |
| Locus tag | NLZ16_RS17695 | Protein ID | WP_000344800.1 |
| Coordinates | 3708412..3708786 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NLZ16_RS17685 (3703501) | 3703501..3704694 | + | 1194 | WP_001295833.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| NLZ16_RS17690 (3704717) | 3704717..3707866 | + | 3150 | WP_001132480.1 | efflux RND transporter permease AcrB | - |
| NLZ16_RS17695 (3708412) | 3708412..3708786 | + | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
| NLZ16_RS17700 (3708812) | 3708812..3709030 | + | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
| NLZ16_RS17705 (3709202) | 3709202..3709753 | + | 552 | WP_000102564.1 | maltose O-acetyltransferase | - |
| NLZ16_RS17710 (3709869) | 3709869..3710339 | + | 471 | WP_000136192.1 | YlaC family protein | - |
| NLZ16_RS17715 (3710503) | 3710503..3712053 | + | 1551 | WP_001366446.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
| NLZ16_RS17720 (3712095) | 3712095..3712448 | - | 354 | WP_001550741.1 | DUF1428 family protein | - |
| NLZ16_RS17730 (3712827) | 3712827..3713138 | + | 312 | WP_000409911.1 | MGMT family protein | - |
| NLZ16_RS17735 (3713169) | 3713169..3713741 | - | 573 | WP_000779831.1 | YbaY family lipoprotein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T250625 WP_001291435.1 NZ_CP100486:3708812-3709030 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT250625 WP_000344800.1 NZ_CP100486:3708412-3708786 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| PDB | 2MW2 | |
| PDB | 1JW2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9QBQ5 |