Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/RelE-HTH_XRE |
Location | 3307223..3307928 | Replicon | chromosome |
Accession | NZ_CP100486 | ||
Organism | Escherichia coli strain LH85-a |
Toxin (Protein)
Gene name | relE | Uniprot ID | S1F406 |
Locus tag | NLZ16_RS15935 | Protein ID | WP_000539521.1 |
Coordinates | 3307223..3307609 (+) | Length | 129 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | NLZ16_RS15940 | Protein ID | WP_001280945.1 |
Coordinates | 3307599..3307928 (+) | Length | 110 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NLZ16_RS15915 (3303227) | 3303227..3303853 | + | 627 | WP_001295292.1 | glutathione S-transferase GstB | - |
NLZ16_RS15920 (3303850) | 3303850..3304965 | - | 1116 | WP_000555051.1 | aldose sugar dehydrogenase YliI | - |
NLZ16_RS15925 (3305076) | 3305076..3305459 | - | 384 | WP_000497137.1 | biofilm formation regulator BssR | - |
NLZ16_RS15930 (3305672) | 3305672..3306997 | + | 1326 | WP_000049367.1 | 30S ribosomal protein S12 methylthiotransferase RimO | - |
NLZ16_RS15935 (3307223) | 3307223..3307609 | + | 387 | WP_000539521.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NLZ16_RS15940 (3307599) | 3307599..3307928 | + | 330 | WP_001280945.1 | DNA-binding transcriptional regulator | Antitoxin |
NLZ16_RS15945 (3307998) | 3307998..3309326 | - | 1329 | WP_001550887.1 | GGDEF domain-containing protein | - |
NLZ16_RS15950 (3309334) | 3309334..3311682 | - | 2349 | WP_001550886.1 | EAL domain-containing protein | - |
NLZ16_RS15955 (3311860) | 3311860..3312771 | - | 912 | WP_001236042.1 | glutathione ABC transporter permease GsiD | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 129 a.a. Molecular weight: 14293.45 Da Isoelectric Point: 9.9296
>T250624 WP_000539521.1 NZ_CP100486:3307223-3307609 [Escherichia coli]
MGVYKARRFSQSTKKLGIHDKVLMAAAEEVMQGIWEADLGSGVIKKRLPLQQGKSGGARTIIFFKSANHVFFYDGWSKSG
LSSKGTKEIEDDELAAYKKMANAFLAFSNKQIEDLIETGFLIEVKNER
MGVYKARRFSQSTKKLGIHDKVLMAAAEEVMQGIWEADLGSGVIKKRLPLQQGKSGGARTIIFFKSANHVFFYDGWSKSG
LSSKGTKEIEDDELAAYKKMANAFLAFSNKQIEDLIETGFLIEVKNER
Download Length: 387 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|