Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
| Location | 2586332..2586970 | Replicon | chromosome |
| Accession | NZ_CP100486 | ||
| Organism | Escherichia coli strain LH85-a | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | A0A7U9DHD1 |
| Locus tag | NLZ16_RS12440 | Protein ID | WP_000813795.1 |
| Coordinates | 2586332..2586508 (+) | Length | 59 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | NLZ16_RS12445 | Protein ID | WP_076797675.1 |
| Coordinates | 2586554..2586970 (+) | Length | 139 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NLZ16_RS12420 (2581954) | 2581954..2583126 | - | 1173 | WP_001551088.1 | BenE family transporter YdcO | - |
| NLZ16_RS12425 (2583218) | 2583218..2583754 | + | 537 | WP_001551089.1 | DNA-binding transcriptional regulator SutR | - |
| NLZ16_RS12430 (2583827) | 2583827..2585788 | + | 1962 | WP_001551090.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
| NLZ16_RS12435 (2585880) | 2585880..2586110 | - | 231 | WP_023910283.1 | YncJ family protein | - |
| NLZ16_RS12440 (2586332) | 2586332..2586508 | + | 177 | WP_000813795.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
| NLZ16_RS12445 (2586554) | 2586554..2586970 | + | 417 | WP_076797675.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
| NLZ16_RS12450 (2587049) | 2587049..2588455 | + | 1407 | WP_001551093.1 | PLP-dependent aminotransferase family protein | - |
| NLZ16_RS12455 (2588700) | 2588700..2589845 | + | 1146 | WP_001551094.1 | ABC transporter substrate-binding protein | - |
| NLZ16_RS12460 (2589863) | 2589863..2590876 | + | 1014 | WP_001551095.1 | ABC transporter ATP-binding protein | - |
| NLZ16_RS12465 (2590877) | 2590877..2591818 | + | 942 | WP_001251315.1 | ABC transporter permease | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6747.80 Da Isoelectric Point: 11.5666
>T250621 WP_000813795.1 NZ_CP100486:2586332-2586508 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPSEEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPSEEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15220.55 Da Isoelectric Point: 4.7386
>AT250621 WP_076797675.1 NZ_CP100486:2586554-2586970 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPSNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPSNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|