Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 1058570..1059224 | Replicon | chromosome |
Accession | NZ_CP100486 | ||
Organism | Escherichia coli strain LH85-a |
Toxin (Protein)
Gene name | cptA | Uniprot ID | S1PAM6 |
Locus tag | NLZ16_RS05110 | Protein ID | WP_000244781.1 |
Coordinates | 1058817..1059224 (+) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | A0A0V9GG32 |
Locus tag | NLZ16_RS05105 | Protein ID | WP_001564007.1 |
Coordinates | 1058570..1058836 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NLZ16_RS05085 (1054658) | 1054658..1056091 | - | 1434 | WP_001513393.1 | 6-phospho-beta-glucosidase BglA | - |
NLZ16_RS05090 (1056136) | 1056136..1056447 | + | 312 | WP_001182951.1 | N(4)-acetylcytidine aminohydrolase | - |
NLZ16_RS05095 (1056611) | 1056611..1057270 | + | 660 | WP_000250274.1 | hemolysin III family protein | - |
NLZ16_RS05100 (1057347) | 1057347..1058327 | - | 981 | WP_001564008.1 | tRNA-modifying protein YgfZ | - |
NLZ16_RS05105 (1058570) | 1058570..1058836 | + | 267 | WP_001564007.1 | FAD assembly factor SdhE | Antitoxin |
NLZ16_RS05110 (1058817) | 1058817..1059224 | + | 408 | WP_000244781.1 | protein YgfX | Toxin |
NLZ16_RS05115 (1059264) | 1059264..1059785 | - | 522 | WP_001055874.1 | flavodoxin FldB | - |
NLZ16_RS05120 (1059897) | 1059897..1060793 | + | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
NLZ16_RS05125 (1060818) | 1060818..1061528 | + | 711 | WP_000715213.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
NLZ16_RS05130 (1061534) | 1061534..1063267 | + | 1734 | WP_000813188.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16061.99 Da Isoelectric Point: 11.5202
>T250613 WP_000244781.1 NZ_CP100486:1058817-1059224 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | S1PAM6 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0V9GG32 |