Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 941698..942533 | Replicon | chromosome |
| Accession | NZ_CP100486 | ||
| Organism | Escherichia coli strain LH85-a | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | - |
| Locus tag | NLZ16_RS04500 | Protein ID | WP_057109034.1 |
| Coordinates | 941698..942075 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | - |
| Locus tag | NLZ16_RS04505 | Protein ID | WP_088569162.1 |
| Coordinates | 942165..942533 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NLZ16_RS04470 (936825) | 936825..937973 | - | 1149 | WP_000905920.1 | capsule polysaccharide export inner-membrane protein KpsE | - |
| NLZ16_RS04475 (938045) | 938045..939028 | - | 984 | WP_001298261.1 | KpsF/GutQ family sugar-phosphate isomerase | - |
| NLZ16_RS04480 (939839) | 939839..940009 | - | 171 | Protein_880 | IS110 family transposase | - |
| NLZ16_RS04485 (940352) | 940352..941194 | - | 843 | WP_072693117.1 | DUF4942 domain-containing protein | - |
| NLZ16_RS04490 (941279) | 941279..941476 | - | 198 | WP_023563519.1 | DUF957 domain-containing protein | - |
| NLZ16_RS04495 (941552) | 941552..941701 | - | 150 | Protein_883 | DUF5983 family protein | - |
| NLZ16_RS04500 (941698) | 941698..942075 | - | 378 | WP_057109034.1 | TA system toxin CbtA family protein | Toxin |
| NLZ16_RS04505 (942165) | 942165..942533 | - | 369 | WP_088569162.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| NLZ16_RS04510 (942583) | 942583..943227 | - | 645 | WP_252713935.1 | antitoxin of toxin-antitoxin stability system | - |
| NLZ16_RS04515 (943246) | 943246..943467 | - | 222 | WP_000692323.1 | DUF987 domain-containing protein | - |
| NLZ16_RS04520 (943530) | 943530..944006 | - | 477 | WP_001366830.1 | RadC family protein | - |
| NLZ16_RS04525 (944022) | 944022..944501 | - | 480 | WP_000860074.1 | antirestriction protein | - |
| NLZ16_RS04530 (944583) | 944583..945401 | - | 819 | WP_001234688.1 | DUF932 domain-containing protein | - |
| NLZ16_RS04535 (945502) | 945502..945654 | - | 153 | WP_001696589.1 | DUF905 family protein | - |
| NLZ16_RS04540 (945660) | 945660..946349 | - | 690 | WP_109475807.1 | hypothetical protein | - |
| NLZ16_RS04545 (946468) | 946468..947352 | - | 885 | WP_023563932.1 | 50S ribosome-binding GTPase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 939839..939994 | 155 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 13934.86 Da Isoelectric Point: 6.8517
>T250612 WP_057109034.1 NZ_CP100486:c942075-941698 [Escherichia coli]
MKTLPDTHVREASCCPSPVTIWQTLLTRLLDQHYGLALNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGASSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEAKQ
MKTLPDTHVREASCCPSPVTIWQTLLTRLLDQHYGLALNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGASSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEAKQ
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13754.55 Da Isoelectric Point: 6.8270
>AT250612 WP_088569162.1 NZ_CP100486:c942533-942165 [Escherichia coli]
VSDTLPGTTHHDDNHDRLWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYHPDQTFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
VSDTLPGTTHHDDNHDRLWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYHPDQTFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|