Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 941698..942533 Replicon chromosome
Accession NZ_CP100486
Organism Escherichia coli strain LH85-a

Toxin (Protein)


Gene name yeeV Uniprot ID -
Locus tag NLZ16_RS04500 Protein ID WP_057109034.1
Coordinates 941698..942075 (-) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID -
Locus tag NLZ16_RS04505 Protein ID WP_088569162.1
Coordinates 942165..942533 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NLZ16_RS04470 (936825) 936825..937973 - 1149 WP_000905920.1 capsule polysaccharide export inner-membrane protein KpsE -
NLZ16_RS04475 (938045) 938045..939028 - 984 WP_001298261.1 KpsF/GutQ family sugar-phosphate isomerase -
NLZ16_RS04480 (939839) 939839..940009 - 171 Protein_880 IS110 family transposase -
NLZ16_RS04485 (940352) 940352..941194 - 843 WP_072693117.1 DUF4942 domain-containing protein -
NLZ16_RS04490 (941279) 941279..941476 - 198 WP_023563519.1 DUF957 domain-containing protein -
NLZ16_RS04495 (941552) 941552..941701 - 150 Protein_883 DUF5983 family protein -
NLZ16_RS04500 (941698) 941698..942075 - 378 WP_057109034.1 TA system toxin CbtA family protein Toxin
NLZ16_RS04505 (942165) 942165..942533 - 369 WP_088569162.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
NLZ16_RS04510 (942583) 942583..943227 - 645 WP_252713935.1 antitoxin of toxin-antitoxin stability system -
NLZ16_RS04515 (943246) 943246..943467 - 222 WP_000692323.1 DUF987 domain-containing protein -
NLZ16_RS04520 (943530) 943530..944006 - 477 WP_001366830.1 RadC family protein -
NLZ16_RS04525 (944022) 944022..944501 - 480 WP_000860074.1 antirestriction protein -
NLZ16_RS04530 (944583) 944583..945401 - 819 WP_001234688.1 DUF932 domain-containing protein -
NLZ16_RS04535 (945502) 945502..945654 - 153 WP_001696589.1 DUF905 family protein -
NLZ16_RS04540 (945660) 945660..946349 - 690 WP_109475807.1 hypothetical protein -
NLZ16_RS04545 (946468) 946468..947352 - 885 WP_023563932.1 50S ribosome-binding GTPase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- flank IS/Tn - - 939839..939994 155


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(19-117)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 13934.86 Da        Isoelectric Point: 6.8517

>T250612 WP_057109034.1 NZ_CP100486:c942075-941698 [Escherichia coli]
MKTLPDTHVREASCCPSPVTIWQTLLTRLLDQHYGLALNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGASSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEAKQ

Download         Length: 378 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13754.55 Da        Isoelectric Point: 6.8270

>AT250612 WP_088569162.1 NZ_CP100486:c942533-942165 [Escherichia coli]
VSDTLPGTTHHDDNHDRLWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYHPDQTFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References