Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 794898..795655 | Replicon | chromosome |
| Accession | NZ_CP100486 | ||
| Organism | Escherichia coli strain LH85-a | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | F4TJC5 |
| Locus tag | NLZ16_RS03815 | Protein ID | WP_001094452.1 |
| Coordinates | 795281..795655 (+) | Length | 125 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A8S7WZL4 |
| Locus tag | NLZ16_RS03810 | Protein ID | WP_071788590.1 |
| Coordinates | 794898..795191 (+) | Length | 98 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NLZ16_RS03790 (792572) | 792572..793390 | + | 819 | WP_001564116.1 | DUF932 domain-containing protein | - |
| NLZ16_RS03795 (793482) | 793482..793967 | + | 486 | WP_000206669.1 | antirestriction protein | - |
| NLZ16_RS03800 (793983) | 793983..794459 | + | 477 | WP_001186706.1 | RadC family protein | - |
| NLZ16_RS03805 (794522) | 794522..794743 | + | 222 | WP_000692345.1 | DUF987 domain-containing protein | - |
| NLZ16_RS03810 (794898) | 794898..795191 | + | 294 | WP_071788590.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| NLZ16_RS03815 (795281) | 795281..795655 | + | 375 | WP_001094452.1 | TA system toxin CbtA family protein | Toxin |
| NLZ16_RS03820 (795652) | 795652..796143 | + | 492 | WP_000976868.1 | DUF5983 family protein | - |
| NLZ16_RS03825 (796155) | 796155..796352 | + | 198 | WP_000772035.1 | DUF957 domain-containing protein | - |
| NLZ16_RS03830 (796449) | 796449..797294 | + | 846 | WP_001290254.1 | DUF4942 domain-containing protein | - |
| NLZ16_RS03840 (797593) | 797593..798099 | + | 507 | WP_000228937.1 | G/U mismatch-specific DNA glycosylase | - |
| NLZ16_RS03845 (798178) | 798178..800019 | - | 1842 | WP_000437371.1 | RNA polymerase sigma factor RpoD | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 14014.86 Da Isoelectric Point: 7.2920
>T250611 WP_001094452.1 NZ_CP100486:795281-795655 [Escherichia coli]
MNTLPDTHVREASRCSSPVTIWQTLLTRLLDQHYGLTLNDTPFSDERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSTDILRARRATGLMTRDNYRTVNNITLGKHPEAK
MNTLPDTHVREASRCSSPVTIWQTLLTRLLDQHYGLTLNDTPFSDERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSTDILRARRATGLMTRDNYRTVNNITLGKHPEAK
Download Length: 375 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|