Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
Location | 72581..73413 | Replicon | chromosome |
Accession | NZ_CP100486 | ||
Organism | Escherichia coli strain LH85-a |
Toxin (Protein)
Gene name | yeeV | Uniprot ID | S1PD64 |
Locus tag | NLZ16_RS00310 | Protein ID | WP_000854753.1 |
Coordinates | 72581..72955 (-) | Length | 125 a.a. |
Antitoxin (Protein)
Gene name | yeeU | Uniprot ID | Q5I3J0 |
Locus tag | NLZ16_RS00315 | Protein ID | WP_001280951.1 |
Coordinates | 73045..73413 (-) | Length | 123 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NLZ16_RS00280 (67948) | 67948..68871 | - | 924 | WP_000535949.1 | carboxylate/amino acid/amine transporter | - |
NLZ16_RS00285 (68982) | 68982..70166 | - | 1185 | WP_001172876.1 | sugar efflux transporter | - |
NLZ16_RS00290 (70571) | 70571..70776 | - | 206 | Protein_57 | virulence RhuM family protein | - |
NLZ16_RS00295 (70957) | 70957..71802 | - | 846 | WP_001406222.1 | DUF4942 domain-containing protein | - |
NLZ16_RS00300 (71887) | 71887..72084 | - | 198 | WP_000839243.1 | DUF957 domain-containing protein | - |
NLZ16_RS00305 (72096) | 72096..72584 | - | 489 | WP_001549830.1 | DUF5983 family protein | - |
NLZ16_RS00310 (72581) | 72581..72955 | - | 375 | WP_000854753.1 | TA system toxin CbtA family protein | Toxin |
NLZ16_RS00315 (73045) | 73045..73413 | - | 369 | WP_001280951.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
NLZ16_RS00320 (73576) | 73576..73797 | - | 222 | WP_001405861.1 | DUF987 domain-containing protein | - |
NLZ16_RS00325 (73866) | 73866..74342 | - | 477 | WP_001186724.1 | RadC family protein | - |
NLZ16_RS00330 (74358) | 74358..74843 | - | 486 | WP_001469549.1 | antirestriction protein | - |
NLZ16_RS00335 (74898) | 74898..75716 | - | 819 | WP_001234620.1 | DUF932 domain-containing protein | - |
NLZ16_RS00340 (75816) | 75816..76049 | - | 234 | WP_001119729.1 | DUF905 family protein | - |
NLZ16_RS00345 (76128) | 76128..76583 | - | 456 | WP_000581504.1 | IrmA family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 14005.00 Da Isoelectric Point: 8.2905
>T250608 WP_000854753.1 NZ_CP100486:c72955-72581 [Escherichia coli]
MKTLPDTHVREASSCPSPVTIWQTLLSRLLGQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCPRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEKR
MKTLPDTHVREASSCPSPVTIWQTLLSRLLGQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCPRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEKR
Download Length: 375 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9LVU0 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | Q5I3J0 |