Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
Location | 5850877..5851487 | Replicon | chromosome |
Accession | NZ_CP100482 | ||
Organism | Klebsiella grimontii strain LH87-a |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | NLZ17_RS28050 | Protein ID | WP_098363641.1 |
Coordinates | 5850877..5851251 (-) | Length | 125 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | NLZ17_RS28055 | Protein ID | WP_077265771.1 |
Coordinates | 5851248..5851487 (-) | Length | 80 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NLZ17_RS28035 (NLZ17_28035) | 5848032..5848934 | + | 903 | WP_004122548.1 | formate dehydrogenase subunit beta | - |
NLZ17_RS28040 (NLZ17_28040) | 5848931..5849566 | + | 636 | WP_004132860.1 | formate dehydrogenase cytochrome b556 subunit | - |
NLZ17_RS28045 (NLZ17_28045) | 5849910..5850839 | + | 930 | WP_004132861.1 | formate dehydrogenase accessory protein FdhE | - |
NLZ17_RS28050 (NLZ17_28050) | 5850877..5851251 | - | 375 | WP_098363641.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
NLZ17_RS28055 (NLZ17_28055) | 5851248..5851487 | - | 240 | WP_077265771.1 | CopG family transcriptional regulator | Antitoxin |
NLZ17_RS28060 (NLZ17_28060) | 5851693..5852610 | + | 918 | WP_024360706.1 | alpha/beta hydrolase | - |
NLZ17_RS28065 (NLZ17_28065) | 5852628..5853569 | - | 942 | WP_004127112.1 | fatty acid biosynthesis protein FabY | - |
NLZ17_RS28070 (NLZ17_28070) | 5853614..5854051 | - | 438 | WP_004132870.1 | D-aminoacyl-tRNA deacylase | - |
NLZ17_RS28075 (NLZ17_28075) | 5854048..5854908 | - | 861 | WP_024360708.1 | virulence factor BrkB family protein | - |
NLZ17_RS28080 (NLZ17_28080) | 5854902..5855501 | - | 600 | WP_024360709.1 | glucose-1-phosphatase | - |
NLZ17_RS28085 (NLZ17_28085) | 5855631..5856416 | - | 786 | WP_064342034.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 14081.36 Da Isoelectric Point: 8.4571
>T250607 WP_098363641.1 NZ_CP100482:c5851251-5850877 [Klebsiella grimontii]
MIKGPALFDTNILIDLFSGRVEAKQVLEAYPPQNAISLITWTEVMVGAKKYHQEHRTRIALSAFNIIDISQDIAERSVNL
RKEYGMKLPDAIILATAQIHRYELVTRNTKDFFGIPGVITPYHL
MIKGPALFDTNILIDLFSGRVEAKQVLEAYPPQNAISLITWTEVMVGAKKYHQEHRTRIALSAFNIIDISQDIAERSVNL
RKEYGMKLPDAIILATAQIHRYELVTRNTKDFFGIPGVITPYHL
Download Length: 375 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|