Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 4532116..4532735 | Replicon | chromosome |
| Accession | NZ_CP100482 | ||
| Organism | Klebsiella grimontii strain LH87-a | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | H3N9D8 |
| Locus tag | NLZ17_RS21890 | Protein ID | WP_004099646.1 |
| Coordinates | 4532517..4532735 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | H3N7X7 |
| Locus tag | NLZ17_RS21885 | Protein ID | WP_004129911.1 |
| Coordinates | 4532116..4532490 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NLZ17_RS21875 (NLZ17_21875) | 4527285..4528478 | + | 1194 | WP_004136054.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| NLZ17_RS21880 (NLZ17_21880) | 4528501..4531647 | + | 3147 | WP_004848339.1 | multidrug efflux RND transporter permease subunit AcrB | - |
| NLZ17_RS21885 (NLZ17_21885) | 4532116..4532490 | + | 375 | WP_004129911.1 | Hha toxicity modulator TomB | Antitoxin |
| NLZ17_RS21890 (NLZ17_21890) | 4532517..4532735 | + | 219 | WP_004099646.1 | HHA domain-containing protein | Toxin |
| NLZ17_RS21895 (NLZ17_21895) | 4532897..4533463 | + | 567 | WP_004136050.1 | maltose O-acetyltransferase | - |
| NLZ17_RS21900 (NLZ17_21900) | 4533435..4533569 | - | 135 | WP_223226911.1 | hypothetical protein | - |
| NLZ17_RS21905 (NLZ17_21905) | 4533590..4534060 | + | 471 | WP_004136048.1 | YlaC family protein | - |
| NLZ17_RS21910 (NLZ17_21910) | 4534035..4535489 | - | 1455 | WP_154975508.1 | PLP-dependent aminotransferase family protein | - |
| NLZ17_RS21915 (NLZ17_21915) | 4535590..4536288 | + | 699 | WP_004136044.1 | GNAT family protein | - |
| NLZ17_RS21920 (NLZ17_21920) | 4536285..4536425 | - | 141 | WP_003859006.1 | type B 50S ribosomal protein L36 | - |
| NLZ17_RS21925 (NLZ17_21925) | 4536425..4536688 | - | 264 | WP_004129897.1 | type B 50S ribosomal protein L31 | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8640.05 Da Isoelectric Point: 8.9008
>T250605 WP_004099646.1 NZ_CP100482:4532517-4532735 [Klebsiella grimontii]
MSDKTLTKIDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPPSVWKFIR
MSDKTLTKIDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPPSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14350.09 Da Isoelectric Point: 4.8989
>AT250605 WP_004129911.1 NZ_CP100482:4532116-4532490 [Klebsiella grimontii]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIAAFALNYKIKYAEDNKLITQIDEYL
DDTFVLFSNYGINSADLQKWRKSGNRLFRCFVNASRENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIAAFALNYKIKYAEDNKLITQIDEYL
DDTFVLFSNYGINSADLQKWRKSGNRLFRCFVNASRENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3H713 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3HD25 |