Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 4532116..4532735 Replicon chromosome
Accession NZ_CP100482
Organism Klebsiella grimontii strain LH87-a

Toxin (Protein)


Gene name Hha Uniprot ID H3N9D8
Locus tag NLZ17_RS21890 Protein ID WP_004099646.1
Coordinates 4532517..4532735 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID H3N7X7
Locus tag NLZ17_RS21885 Protein ID WP_004129911.1
Coordinates 4532116..4532490 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NLZ17_RS21875 (NLZ17_21875) 4527285..4528478 + 1194 WP_004136054.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
NLZ17_RS21880 (NLZ17_21880) 4528501..4531647 + 3147 WP_004848339.1 multidrug efflux RND transporter permease subunit AcrB -
NLZ17_RS21885 (NLZ17_21885) 4532116..4532490 + 375 WP_004129911.1 Hha toxicity modulator TomB Antitoxin
NLZ17_RS21890 (NLZ17_21890) 4532517..4532735 + 219 WP_004099646.1 HHA domain-containing protein Toxin
NLZ17_RS21895 (NLZ17_21895) 4532897..4533463 + 567 WP_004136050.1 maltose O-acetyltransferase -
NLZ17_RS21900 (NLZ17_21900) 4533435..4533569 - 135 WP_223226911.1 hypothetical protein -
NLZ17_RS21905 (NLZ17_21905) 4533590..4534060 + 471 WP_004136048.1 YlaC family protein -
NLZ17_RS21910 (NLZ17_21910) 4534035..4535489 - 1455 WP_154975508.1 PLP-dependent aminotransferase family protein -
NLZ17_RS21915 (NLZ17_21915) 4535590..4536288 + 699 WP_004136044.1 GNAT family protein -
NLZ17_RS21920 (NLZ17_21920) 4536285..4536425 - 141 WP_003859006.1 type B 50S ribosomal protein L36 -
NLZ17_RS21925 (NLZ17_21925) 4536425..4536688 - 264 WP_004129897.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8640.05 Da        Isoelectric Point: 8.9008

>T250605 WP_004099646.1 NZ_CP100482:4532517-4532735 [Klebsiella grimontii]
MSDKTLTKIDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPPSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14350.09 Da        Isoelectric Point: 4.8989

>AT250605 WP_004129911.1 NZ_CP100482:4532116-4532490 [Klebsiella grimontii]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIAAFALNYKIKYAEDNKLITQIDEYL
DDTFVLFSNYGINSADLQKWRKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3H713

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3HD25

References