Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 900034..900691 | Replicon | chromosome |
| Accession | NZ_CP100482 | ||
| Organism | Klebsiella grimontii strain LH87-a | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | A0A9E1DA00 |
| Locus tag | NLZ17_RS04415 | Protein ID | WP_024358614.1 |
| Coordinates | 900281..900691 (+) | Length | 137 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | H3N295 |
| Locus tag | NLZ17_RS04410 | Protein ID | WP_004124953.1 |
| Coordinates | 900034..900300 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NLZ17_RS04395 (NLZ17_04395) | 895286..895711 | - | 426 | WP_024358617.1 | PTS sugar transporter subunit IIA | - |
| NLZ17_RS04400 (NLZ17_04400) | 895832..898630 | - | 2799 | WP_154930991.1 | transcriptional regulator DagR | - |
| NLZ17_RS04405 (NLZ17_04405) | 898806..899789 | - | 984 | WP_024358615.1 | tRNA-modifying protein YgfZ | - |
| NLZ17_RS04410 (NLZ17_04410) | 900034..900300 | + | 267 | WP_004124953.1 | FAD assembly factor SdhE | Antitoxin |
| NLZ17_RS04415 (NLZ17_04415) | 900281..900691 | + | 411 | WP_024358614.1 | protein YgfX | Toxin |
| NLZ17_RS04420 (NLZ17_04420) | 900700..901221 | - | 522 | WP_024358613.1 | flavodoxin FldB | - |
| NLZ17_RS04425 (NLZ17_04425) | 901343..902239 | + | 897 | WP_154930993.1 | site-specific tyrosine recombinase XerD | - |
| NLZ17_RS04430 (NLZ17_04430) | 902262..902975 | + | 714 | WP_004134425.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| NLZ17_RS04435 (NLZ17_04435) | 902981..904714 | + | 1734 | WP_098066860.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 16135.97 Da Isoelectric Point: 10.9455
>T250599 WP_024358614.1 NZ_CP100482:900281-900691 [Klebsiella grimontii]
VVLWQSDLRISWRAQWFSLLMHGVVAALVLLMPWPLSYTPLWLILLSLVVFDCVRSQRRIHARQGEIKLLIDSRLRWQKA
EWEIIGTPWVINSGMLLRLRNTENQRTQHLWVAADSMDAGEWRDLRRLVLQKPTQE
VVLWQSDLRISWRAQWFSLLMHGVVAALVLLMPWPLSYTPLWLILLSLVVFDCVRSQRRIHARQGEIKLLIDSRLRWQKA
EWEIIGTPWVINSGMLLRLRNTENQRTQHLWVAADSMDAGEWRDLRRLVLQKPTQE
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|