Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 4640474..4640990 | Replicon | chromosome |
Accession | NZ_CP100478 | ||
Organism | Klebsiella pneumoniae strain LH99-d |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | NLZ18_RS22490 | Protein ID | WP_040237797.1 |
Coordinates | 4640474..4640758 (-) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | R4Y888 |
Locus tag | NLZ18_RS22495 | Protein ID | WP_002886901.1 |
Coordinates | 4640748..4640990 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NLZ18_RS22465 (4635877) | 4635877..4636140 | - | 264 | WP_025368518.1 | PTS sugar transporter subunit IIB | - |
NLZ18_RS22470 (4636270) | 4636270..4636443 | + | 174 | WP_032412860.1 | hypothetical protein | - |
NLZ18_RS22475 (4636446) | 4636446..4637189 | + | 744 | WP_002886905.1 | MurR/RpiR family transcriptional regulator | - |
NLZ18_RS22480 (4637546) | 4637546..4639684 | + | 2139 | WP_004222153.1 | anaerobic ribonucleoside-triphosphate reductase | - |
NLZ18_RS22485 (4640006) | 4640006..4640470 | + | 465 | WP_004178375.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
NLZ18_RS22490 (4640474) | 4640474..4640758 | - | 285 | WP_040237797.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NLZ18_RS22495 (4640748) | 4640748..4640990 | - | 243 | WP_002886901.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
NLZ18_RS22500 (4641068) | 4641068..4642978 | - | 1911 | WP_117054542.1 | PRD domain-containing protein | - |
NLZ18_RS22505 (4643001) | 4643001..4644155 | - | 1155 | WP_040237796.1 | lactonase family protein | - |
NLZ18_RS22510 (4644222) | 4644222..4644962 | - | 741 | WP_004186692.1 | KDGP aldolase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11067.91 Da Isoelectric Point: 10.4962
>T250593 WP_040237797.1 NZ_CP100478:c4640758-4640474 [Klebsiella pneumoniae]
MTYELAFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESARLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
MTYELAFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESARLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|