Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-StbC |
| Location | 4977780..4978447 | Replicon | chromosome |
| Accession | NZ_CP100476 | ||
| Organism | Mesorhizobium sp. C120A | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | V7HJC5 |
| Locus tag | NL532_RS24440 | Protein ID | WP_023689057.1 |
| Coordinates | 4977780..4978196 (-) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | V7HL59 |
| Locus tag | NL532_RS24445 | Protein ID | WP_023670289.1 |
| Coordinates | 4978193..4978447 (-) | Length | 85 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NL532_RS24405 (NL532_24360) | 4973058..4973279 | + | 222 | WP_023829011.1 | hypothetical protein | - |
| NL532_RS24410 (NL532_24365) | 4973282..4973536 | - | 255 | WP_023829012.1 | DUF982 domain-containing protein | - |
| NL532_RS24415 (NL532_24370) | 4973599..4974819 | + | 1221 | WP_023829013.1 | RNA-guided endonuclease TnpB family protein | - |
| NL532_RS24420 (NL532_24375) | 4975063..4976142 | + | 1080 | WP_050590953.1 | site-specific integrase | - |
| NL532_RS24430 (NL532_24385) | 4976521..4976820 | + | 300 | WP_023829015.1 | hypothetical protein | - |
| NL532_RS24435 (NL532_24390) | 4977212..4977472 | + | 261 | WP_023689056.1 | hypothetical protein | - |
| NL532_RS24440 (NL532_24395) | 4977780..4978196 | - | 417 | WP_023689057.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| NL532_RS24445 (NL532_24400) | 4978193..4978447 | - | 255 | WP_023670289.1 | plasmid stabilization protein | Antitoxin |
| NL532_RS24450 (NL532_24405) | 4978571..4979275 | - | 705 | WP_023689058.1 | DnaA regulatory inactivator HdaA | - |
| NL532_RS24455 (NL532_24410) | 4979278..4980471 | - | 1194 | WP_023684761.1 | AI-2E family transporter | - |
| NL532_RS24460 (NL532_24415) | 4980443..4980998 | - | 556 | Protein_4838 | CDP-alcohol phosphatidyltransferase family protein | - |
| NL532_RS24465 (NL532_24420) | 4981186..4982265 | + | 1080 | WP_023689059.1 | phosphoribosylformylglycinamidine cyclo-ligase | - |
| NL532_RS24470 (NL532_24425) | 4982262..4982969 | + | 708 | WP_023689060.1 | phosphoribosylglycinamide formyltransferase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 14814.00 Da Isoelectric Point: 5.5797
>T250582 WP_023689057.1 NZ_CP100476:c4978196-4977780 [Mesorhizobium sp. C120A]
MILLDTNVVSEAMKPEPHQAVLAWLDDQAEETLYLSSVTLAEVLFGIEAMPAGRRKAALAETFAGVCAVFERRILPFDTE
AARHYARLAVKARAAGKGFPVPDGYIAAIASANGFHLASRDTAPFHAAGVPVIDPWQP
MILLDTNVVSEAMKPEPHQAVLAWLDDQAEETLYLSSVTLAEVLFGIEAMPAGRRKAALAETFAGVCAVFERRILPFDTE
AARHYARLAVKARAAGKGFPVPDGYIAAIASANGFHLASRDTAPFHAAGVPVIDPWQP
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|