Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/HicA-HicA
Location 4043937..4044348 Replicon chromosome
Accession NZ_CP100476
Organism Mesorhizobium sp. C120A

Toxin (Protein)


Gene name hicA Uniprot ID X6KMY1
Locus tag NL532_RS19610 Protein ID WP_023669047.1
Coordinates 4043937..4044137 (+) Length 67 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID X6KJU0
Locus tag NL532_RS19615 Protein ID WP_023669048.1
Coordinates 4044142..4044348 (+) Length 69 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NL532_RS19605 (NL532_19565) 4040166..4043930 + 3765 WP_023829931.1 vitamin B12-dependent ribonucleotide reductase -
NL532_RS19610 (NL532_19570) 4043937..4044137 + 201 WP_023669047.1 type II toxin-antitoxin system HicA family toxin Toxin
NL532_RS19615 (NL532_19575) 4044142..4044348 + 207 WP_023669048.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
NL532_RS19620 (NL532_19580) 4044372..4044977 - 606 WP_245259856.1 hypothetical protein -
NL532_RS19625 (NL532_19585) 4044982..4045518 - 537 WP_245270394.1 hypothetical protein -
NL532_RS19630 (NL532_19590) 4045531..4046502 - 972 WP_023829933.1 DUF3592 domain-containing protein -
NL532_RS19635 (NL532_19595) 4046666..4047607 + 942 WP_023684926.1 phosphoribosylaminoimidazolesuccinocarboxamide synthase -
NL532_RS19640 (NL532_19600) 4047628..4048512 - 885 WP_023829934.1 DMT family transporter -
NL532_RS19645 (NL532_19605) 4048509..4049117 - 609 WP_023694158.1 class I SAM-dependent methyltransferase -
NL532_RS19650 (NL532_19610) 4049146..4049319 - 174 WP_196813891.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 4040166..4057774 17608
- inside Prophage - - 4027559..4057774 30215


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(8-64)

Antitoxin

HicB-like antitoxin of toxin-antitoxin system

(3-66)


Sequences

Toxin        


Download         Length: 67 a.a.        Molecular weight: 7328.51 Da        Isoelectric Point: 10.7459

>T250581 WP_023669047.1 NZ_CP100476:4043937-4044137 [Mesorhizobium sp. C120A]
MPPRLTVREVIRLLETDGWYLVATKGSHRQYKHKTKAGRVTVAGKPSEEVAPGTLNSILKQSGLKE

Download         Length: 201 bp

Antitoxin


Download         Length: 69 a.a.        Molecular weight: 7346.40 Da        Isoelectric Point: 4.3178

>AT250581 WP_023669048.1 NZ_CP100476:4044142-4044348 [Mesorhizobium sp. C120A]
MRYAVVIEKAGNNFSAYVPDLPGCIATGATVPEVEIEIRDAIRFHIEGLRADGLEVPKGISLAEYVEA

Download         Length: 207 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB X6KMY1

Antitoxin

Source ID Structure
AlphaFold DB X6KJU0

References