Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1-VagC |
Location | 2751284..2751954 | Replicon | chromosome |
Accession | NZ_CP100476 | ||
Organism | Mesorhizobium sp. C120A |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | NL532_RS13345 | Protein ID | WP_023829215.1 |
Coordinates | 2751556..2751954 (+) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | NL532_RS13340 | Protein ID | WP_081730991.1 |
Coordinates | 2751284..2751556 (+) | Length | 91 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NL532_RS13320 (NL532_13300) | 2746485..2747627 | - | 1143 | WP_023826558.1 | hypothetical protein | - |
NL532_RS13325 (NL532_13305) | 2747714..2749282 | + | 1569 | WP_081730990.1 | acyl--CoA ligase | - |
NL532_RS13330 (NL532_13310) | 2749348..2749797 | - | 450 | WP_023673075.1 | Rrf2 family transcriptional regulator | - |
NL532_RS13335 (NL532_13315) | 2750057..2751043 | - | 987 | WP_023829213.1 | sulfate ABC transporter substrate-binding protein | - |
NL532_RS13340 (NL532_13320) | 2751284..2751556 | + | 273 | WP_081730991.1 | antitoxin | Antitoxin |
NL532_RS13345 (NL532_13325) | 2751556..2751954 | + | 399 | WP_023829215.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
NL532_RS13350 (NL532_13330) | 2751969..2753018 | - | 1050 | WP_023829216.1 | sulfate/molybdate ABC transporter ATP-binding protein | - |
NL532_RS13355 (NL532_13335) | 2753092..2753976 | - | 885 | WP_023690809.1 | sulfate ABC transporter permease subunit CysW | - |
NL532_RS13360 (NL532_13340) | 2753969..2754820 | - | 852 | WP_023687973.1 | sulfate ABC transporter permease subunit CysT | - |
NL532_RS13365 (NL532_13345) | 2754839..2755867 | - | 1029 | WP_023829217.1 | sulfate ABC transporter substrate-binding protein | - |
NL532_RS13370 (NL532_13350) | 2756098..2756781 | - | 684 | WP_023829218.1 | M15 family metallopeptidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14123.38 Da Isoelectric Point: 6.4544
>T250579 WP_023829215.1 NZ_CP100476:2751556-2751954 [Mesorhizobium sp. C120A]
MRFMLDTNILSDMIRNPAGKAASTAVRAGDGALCTSIVVASELRYGCARKGSAKLLAKVEQLLAELPVLPLDVPMDNEYG
ALRAELEARGQPIGHNDLFIAAHVCALGTTLVTANTGEFSRIKGLKVENWLE
MRFMLDTNILSDMIRNPAGKAASTAVRAGDGALCTSIVVASELRYGCARKGSAKLLAKVEQLLAELPVLPLDVPMDNEYG
ALRAELEARGQPIGHNDLFIAAHVCALGTTLVTANTGEFSRIKGLKVENWLE
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|