Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 2132549..2133177 | Replicon | chromosome |
| Accession | NZ_CP100476 | ||
| Organism | Mesorhizobium sp. C120A | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | V7HPF9 |
| Locus tag | NL532_RS10455 | Protein ID | WP_023724991.1 |
| Coordinates | 2132791..2133177 (+) | Length | 129 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | X6KRM4 |
| Locus tag | NL532_RS10450 | Protein ID | WP_023724992.1 |
| Coordinates | 2132549..2132794 (+) | Length | 82 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NL532_RS10420 (NL532_10405) | 2127658..2128410 | - | 753 | WP_023669968.1 | SDR family NAD(P)-dependent oxidoreductase | - |
| NL532_RS10425 (NL532_10410) | 2128456..2129544 | - | 1089 | WP_023754959.1 | AbrB family transcriptional regulator | - |
| NL532_RS10430 (NL532_10415) | 2129625..2129933 | - | 309 | WP_023691624.1 | putative quinol monooxygenase | - |
| NL532_RS10435 (NL532_10420) | 2130013..2130792 | - | 780 | WP_023686180.1 | SDR family oxidoreductase | - |
| NL532_RS10440 (NL532_10425) | 2130866..2131294 | - | 429 | WP_023754958.1 | DsrE family protein | - |
| NL532_RS10445 (NL532_10430) | 2131395..2132483 | + | 1089 | WP_023754957.1 | hypothetical protein | - |
| NL532_RS10450 (NL532_10435) | 2132549..2132794 | + | 246 | WP_023724992.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| NL532_RS10455 (NL532_10440) | 2132791..2133177 | + | 387 | WP_023724991.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| NL532_RS10460 (NL532_10445) | 2133184..2134131 | - | 948 | WP_023754956.1 | cation diffusion facilitator family transporter | - |
| NL532_RS10465 (NL532_10450) | 2134137..2136326 | - | 2190 | WP_023828139.1 | anthranilate synthase | - |
| NL532_RS10470 (NL532_10455) | 2136647..2137417 | + | 771 | WP_023695831.1 | isocitrate lyase/phosphoenolpyruvate mutase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 129 a.a. Molecular weight: 14208.29 Da Isoelectric Point: 5.6660
>T250577 WP_023724991.1 NZ_CP100476:2132791-2133177 [Mesorhizobium sp. C120A]
VTYLLDTNAVIAIIAGDEGLLALLKRHAPQDFALSAVVLHELYYGAEKSQRKVQNLARIEALQFPVLEFDRDDARHAGEI
RAGLAALGTPIGPYDALIGGQARARDLTLITRNIREFERIKDLTIETW
VTYLLDTNAVIAIIAGDEGLLALLKRHAPQDFALSAVVLHELYYGAEKSQRKVQNLARIEALQFPVLEFDRDDARHAGEI
RAGLAALGTPIGPYDALIGGQARARDLTLITRNIREFERIKDLTIETW
Download Length: 387 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|