Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | PumAB/upstrm_HI1419-dnstrm_HI1420 |
| Location | 5653367..5653949 | Replicon | chromosome |
| Accession | NZ_CP100475 | ||
| Organism | Mesorhizobium sp. C372A | ||
Toxin (Protein)
| Gene name | PumA | Uniprot ID | X6KG12 |
| Locus tag | NLY42_RS27325 | Protein ID | WP_023672746.1 |
| Coordinates | 5653662..5653949 (-) | Length | 96 a.a. |
Antitoxin (Protein)
| Gene name | PumB | Uniprot ID | X6KDU4 |
| Locus tag | NLY42_RS27320 | Protein ID | WP_023672747.1 |
| Coordinates | 5653367..5653660 (-) | Length | 98 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NLY42_RS27290 (NLY42_27275) | 5648688..5649134 | - | 447 | WP_023747898.1 | hypothetical protein | - |
| NLY42_RS27295 (NLY42_27280) | 5649337..5649759 | - | 423 | WP_023747899.1 | glyoxalase | - |
| NLY42_RS27300 (NLY42_27285) | 5649747..5650223 | - | 477 | WP_156933781.1 | MarR family transcriptional regulator | - |
| NLY42_RS27305 (NLY42_27290) | 5650498..5651346 | - | 849 | WP_023747902.1 | 23S rRNA (adenine(2030)-N(6))-methyltransferase RlmJ | - |
| NLY42_RS27310 (NLY42_27295) | 5651354..5651968 | - | 615 | WP_023754721.1 | hypothetical protein | - |
| NLY42_RS27315 (NLY42_27300) | 5652151..5653308 | + | 1158 | WP_031243043.1 | hypothetical protein | - |
| NLY42_RS27320 (NLY42_27305) | 5653367..5653660 | - | 294 | WP_023672747.1 | putative addiction module antidote protein | Antitoxin |
| NLY42_RS27325 (NLY42_27310) | 5653662..5653949 | - | 288 | WP_023672746.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NLY42_RS27330 (NLY42_27315) | 5654002..5655006 | - | 1005 | WP_023754722.1 | Rieske (2Fe-2S) protein | - |
| NLY42_RS27335 (NLY42_27320) | 5655003..5656136 | - | 1134 | WP_023756429.1 | GNAT family N-acetyltransferase | - |
| NLY42_RS27340 (NLY42_27325) | 5656133..5657389 | - | 1257 | WP_023754724.1 | coenzyme F390 synthetase | - |
| NLY42_RS27345 (NLY42_27330) | 5657386..5658210 | - | 825 | WP_023754725.1 | MBL fold metallo-hydrolase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 10788.59 Da Isoelectric Point: 10.6803
>T250574 WP_023672746.1 NZ_CP100475:c5653949-5653662 [Mesorhizobium sp. C372A]
MIEVRSTDEFRKWLRGLTDIRAVKKITQRIVRVQAGLLGDAKFFDGIGELRVDYGPGYRVYFVRRGNTVIILLCGGDKGS
QDRDIGKARKMAKEV
MIEVRSTDEFRKWLRGLTDIRAVKKITQRIVRVQAGLLGDAKFFDGIGELRVDYGPGYRVYFVRRGNTVIILLCGGDKGS
QDRDIGKARKMAKEV
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|