Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
Location | 3590662..3591323 | Replicon | chromosome |
Accession | NZ_CP100475 | ||
Organism | Mesorhizobium sp. C372A |
Toxin (Protein)
Gene name | vapC | Uniprot ID | V7HJQ8 |
Locus tag | NLY42_RS17015 | Protein ID | WP_023682204.1 |
Coordinates | 3590886..3591323 (+) | Length | 146 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | X6KNM3 |
Locus tag | NLY42_RS17010 | Protein ID | WP_023668191.1 |
Coordinates | 3590662..3590889 (+) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NLY42_RS16995 (NLY42_17010) | 3586060..3587094 | + | 1035 | WP_023668188.1 | ABC transporter permease | - |
NLY42_RS17000 (NLY42_17015) | 3587108..3588265 | + | 1158 | WP_023668189.1 | ABC transporter permease | - |
NLY42_RS17005 (NLY42_17020) | 3588313..3590517 | + | 2205 | WP_023753563.1 | ABC transporter ATP-binding protein | - |
NLY42_RS17010 (NLY42_17025) | 3590662..3590889 | + | 228 | WP_023668191.1 | hypothetical protein | Antitoxin |
NLY42_RS17015 (NLY42_17030) | 3590886..3591323 | + | 438 | WP_023682204.1 | PIN domain-containing protein | Toxin |
NLY42_RS17020 (NLY42_17035) | 3591380..3591970 | - | 591 | WP_023707714.1 | transglycosylase SLT domain-containing protein | - |
NLY42_RS17025 (NLY42_17040) | 3592188..3593726 | + | 1539 | WP_023707716.1 | trimethylamine methyltransferase family protein | - |
NLY42_RS17030 (NLY42_17045) | 3593805..3596246 | + | 2442 | WP_023753562.1 | FAD-dependent oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 146 a.a. Molecular weight: 15576.77 Da Isoelectric Point: 6.8429
>T250572 WP_023682204.1 NZ_CP100475:3590886-3591323 [Mesorhizobium sp. C372A]
VTFLLDVNVLIALIDPAHVAHEDAHRWFQSTGHLSWATCPITENGVIRIVSNPKYPNSPGSPAVVAQIVGKLHALSGHQF
WPDEISLVGSNDIDAARILTPAQVTDSYLLGLAKARDGQLATFDRKLSTAAVKGGRSILHLIPSE
VTFLLDVNVLIALIDPAHVAHEDAHRWFQSTGHLSWATCPITENGVIRIVSNPKYPNSPGSPAVVAQIVGKLHALSGHQF
WPDEISLVGSNDIDAARILTPAQVTDSYLLGLAKARDGQLATFDRKLSTAAVKGGRSILHLIPSE
Download Length: 438 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|