Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1-VagC |
| Location | 3562364..3563034 | Replicon | chromosome |
| Accession | NZ_CP100475 | ||
| Organism | Mesorhizobium sp. C372A | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | NLY42_RS16940 | Protein ID | WP_023753568.1 |
| Coordinates | 3562636..3563034 (+) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | X6J8K0 |
| Locus tag | NLY42_RS16935 | Protein ID | WP_023687970.1 |
| Coordinates | 3562364..3562636 (+) | Length | 91 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NLY42_RS16915 (NLY42_16930) | 3557558..3558706 | - | 1149 | WP_023753569.1 | hypothetical protein | - |
| NLY42_RS16920 (NLY42_16935) | 3558793..3560361 | + | 1569 | WP_081839900.1 | acyl--CoA ligase | - |
| NLY42_RS16925 (NLY42_16940) | 3560427..3560876 | - | 450 | WP_023673075.1 | Rrf2 family transcriptional regulator | - |
| NLY42_RS16930 (NLY42_16945) | 3561137..3562123 | - | 987 | WP_023744562.1 | sulfate ABC transporter substrate-binding protein | - |
| NLY42_RS16935 (NLY42_16950) | 3562364..3562636 | + | 273 | WP_023687970.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
| NLY42_RS16940 (NLY42_16955) | 3562636..3563034 | + | 399 | WP_023753568.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| NLY42_RS16945 (NLY42_16960) | 3563049..3564089 | - | 1041 | WP_023673079.1 | sulfate/molybdate ABC transporter ATP-binding protein | - |
| NLY42_RS16950 (NLY42_16965) | 3564163..3565047 | - | 885 | WP_023673080.1 | sulfate ABC transporter permease subunit CysW | - |
| NLY42_RS16955 (NLY42_16970) | 3565040..3565891 | - | 852 | WP_023687973.1 | sulfate ABC transporter permease subunit CysT | - |
| NLY42_RS16960 (NLY42_16975) | 3565910..3566938 | - | 1029 | WP_023673082.1 | sulfate ABC transporter substrate-binding protein | - |
| NLY42_RS16965 (NLY42_16980) | 3567169..3567852 | - | 684 | WP_023753567.1 | M15 family metallopeptidase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14179.44 Da Isoelectric Point: 6.4544
>T250571 WP_023753568.1 NZ_CP100475:3562636-3563034 [Mesorhizobium sp. C372A]
MRFMLDTNIISDMIRNPAGKAASTAVRAGDGALCTSIVVASELRYGCARKGSAKLLAKVEQLLAELPVLPLDVPMDNEYG
ALRAELEARGQPIGHNDLFIAAHACVLGTTLVTANTAEFRRIKGLTVENWLE
MRFMLDTNIISDMIRNPAGKAASTAVRAGDGALCTSIVVASELRYGCARKGSAKLLAKVEQLLAELPVLPLDVPMDNEYG
ALRAELEARGQPIGHNDLFIAAHACVLGTTLVTANTAEFRRIKGLTVENWLE
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|